Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mwcD_

Fold library idPDB HeaderMoleculeTitle
c5mwcD_2.45PDB header: fluorescent proteinChain: D: PDB Molecule: genetically-encoded green calcium indicator ntnc;


Added to library: Sat Feb 17 08:25:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLPATHELHIFGSINGVDFDMVGQGSGNPNVGYEELNLKSTKGDLQFSPWILVPHIFHQYLPYPDGMSPF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTTTTSSS

SS
GGGGTTT

GGG
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QAAMVDGSGYQVHRTVQFEDGASLTVNYRYTYEGSHIKGEAQVKGTGFPADGPVMANSLTAMVPSEEELS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS

TTS
TT


TTSTTTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence ECFRTFDKDGDGFIDREEFGGIIRDPDEIFGDSDTDKNGRIDFDEFLKMVSMADWCRSKMACPNDKTLIS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTSSS
TTTS


TT
SSS





TT
 .........220.........230.........240.........250.........260.........270.....
Sequence TLKWSYTTGNGKRYRSTARTTYTFAKPMAANYLKNQPMYVFRKTELKHSKTELNFKEWQKAFTDV
Predicted secondary structure



























SS confidence
































































Known secondary structure (DSSP) TTS
SS


S


SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D