Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5muxB_

Fold library idPDB HeaderMoleculeTitle
c5muxB_2.00PDB header: lyaseChain: B: PDB Molecule: 2-methylcitrate dehydratase;


Added to library: Sat Feb 17 08:27:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGCGILALRYPECTKLLGPIVPGTTVPNGSKVPG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)









TT
TT
S
SSTT


TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGHPSDNLGGILAAADYVSRVRLSEGKEPLTVRDVLEMM
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S


TTS
S
BSSS
GGGGTT



B
 .........150.........160.........170.........180.........190.........200.........210
Sequence IKAHEIQGVLALENSLNRVGLDHVLFVKVATTAVAAKLLGGGREEIKNALSNAWIDNAALRTYRHSPNTG
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SGGGTB
TTT

T


B
GGGSTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence SRKSWPAGDATSRGVHLALMSLKGEMGYPTALSAPGWGFQDVLFNKKEIKLARPLDAYVMENVLFKVSYP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGGTSTT



TTTTT
TTTSSTT




SS
SSST
B


S

 .........290.........300.........310.........320.........330.........340.........350
Sequence AEFHAQTAAESAVILHPQVKNRIDEIDRVVIRTHESAIRIIDKKGPLHNPADRDHCLQYITAIGLLFGDI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
GGGTT
GGG
T


S


ST
S

 .........360.........370.........380.........390.........400.........410.........420
Sequence TAQHYEAETANDPRIDKLRDKMEVTENKTYTEDYLKPDKRSISNAVQVHFKDGTSTEMVECEFPLGHRFR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGGGST
TT

TTT



TTS
B


SS
TTSGGG
 .........430.........440.........450.........460.........470..
Sequence REEAVPKLLEKFSDNLKTHFPDKQHKHIYERCTSYETLQTMRVNEFVDMFCM
Predicted secondary structure


















SS confidence



















































Known secondary structure (DSSP) S

TTSBTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D