Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5muxB_

Fold library idPDB HeaderMoleculeTitle
c5muxB_2.00PDB header: lyaseChain: B: PDB Molecule: 2-methylcitrate dehydratase;


Added to library: Sat Feb 17 08:27:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGCGILALRYPECTKLLGPIVPGTTVPNGSKVPG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)









TT
TT
S
SSTT


TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGHPSDNLGGILAAADYVSRVRLSEGKEPLTVRDVLEMM
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S


TTS
S
BSSS
GGGGTT



B
 .........150.........160.........170.........180.........190.........200.........210
Sequence IKAHEIQGVLALENSLNRVGLDHVLFVKVATTAVAAKLLGGGREEIKNALSNAWIDNAALRTYRHSPNTG
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SGGGTB
TTT

T


B
GGGSTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence SRKSWPAGDATSRGVHLALMSLKGEMGYPTALSAPGWGFQDVLFNKKEIKLARPLDAYVMENVLFKVSYP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGGTSTT



TTTTT
TTTSSTT




SS
SSST
B


S

 .........290.........300.........310.........320.........330.........340.........350
Sequence AEFHAQTAAESAVILHPQVKNRIDEIDRVVIRTHESAIRIIDKKGPLHNPADRDHCLQYITAIGLLFGDI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
GGGTT
GGG
T


S


ST
S

 .........360.........370.........380.........390.........400.........410.........420
Sequence TAQHYEAETANDPRIDKLRDKMEVTENKTYTEDYLKPDKRSISNAVQVHFKDGTSTEMVECEFPLGHRFR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGGGST
TT

TTT



TTS
B


SS
TTSGGG
 .........430.........440.........450.........460.........470..
Sequence REEAVPKLLEKFSDNLKTHFPDKQHKHIYERCTSYETLQTMRVNEFVDMFCM
Predicted secondary structure


















SS confidence



















































Known secondary structure (DSSP) S

TTSBTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D