Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mszA_

Fold library idPDB HeaderMoleculeTitle
c5mszA_1.10PDB header: oxidoreductaseChain: A: PDB Molecule: thermobia domestica domestica aa15;


Added to library: Sat Mar 3 08:32:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HGHLSVPPMRSSMWRDGYNVPPNYNDDGLNCGSFDVQWVKNGGKCGECGDDYSLPRPRPNESGGMYGKNI
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)
TT
GGGGGGGT
SS


TTTT

STT
TTSTT


TTSS
TTS
SS
TTSTTSTT



 .........80.........90.........100.........110.........120.........130.........140
Sequence IVANYQQGSTISVDLHIQAPHIGFFEFRLCARNDPNVLETQDCFDQHLLELADGSGTRFTMEEHVAGEYT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


TT
SS

S



TTS


TTB
TTSS
S

S


 .........150.........160.........170.........180.........190.....
Sequence VDLKLPQGVTCTNCVLQWFWRTGNRYGDCGDGTSGMGCGPQEEYRNCADIAIAWS
Predicted secondary structure





























SS confidence






















































Known secondary structure (DSSP)

TT



S
SSS
T
S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D