Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5msnA_

Fold library idPDB HeaderMoleculeTitle
c5msnA_2.00PDB header: cell cycleChain: A: PDB Molecule: dcc1 protein;


Added to library: Thu Feb 23 10:11:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HGELNLNSVPIYNGELDFSDKIKVIGTLEELLENSPCSALEGISKWHKIGGSVKDGVLCILSQDFLFKAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S


TT


S
SS





TSSS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HVLLMSAMAESLDLQHLNVEDTHHAVGKDIEDEFNPYTREIIETVLNKFAVQEQENNTWRLRIPFIAQWY
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT

TTSB
TT

SS








S

 .........150.........160.........170.........180.........190.........200.........210
Sequence GIQALRKYVSGISMPIDEFLIKWKSLFPPFFPCDIDIDMLRGYHFKPTDKTVQYIAKSTLPMDPKERFKV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSSS
TTS
TT
S



GGGGTTS
SSTT

GGGS
SS
 .........220.........230.........240.........250.........
Sequence LFRLQSQWDLEDIKPLIEELNSRGMKIDSFIMKYARRKRLGKKTVVTSR
Predicted secondary structure

















SS confidence
















































Known secondary structure (DSSP)
SSGGG
TT


S
SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D