Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mrvB_

Fold library idPDB HeaderMoleculeTitle
c5mrvB_1.85PDB header: hydrolaseChain: B: PDB Molecule: carboxypeptidase o;


Added to library: Sat Jan 20 10:27:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKIIWMDCGIHAREW
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



TTS


TTTT
TT





SS


SSTT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence IAPAFCQWFVKEILQNHKDNSRIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTT
S
S
T
TT

S


TTTT


G
 .........150.........160.........170.........180.........190.........200.........210
Sequence NRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNK
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) GG
SSSSTTSSS
BS
TTSTTB

SSTT
STTTTSS
S
SS
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence SSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGSSRDWARDIGIPFSYTFELRDSGTYGFVLP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
TT



S





TT
SS
SSSSTTS

 .........290.........300.......
Sequence EAQIQPTCEETMEAVLSVLDDVYAKHW
Predicted secondary structure

SS confidence


























Known secondary structure (DSSP) GGGTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D