Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mrtA_

Fold library idPDB HeaderMoleculeTitle
c5mrtA_1.60PDB header: hydrolaseChain: A: PDB Molecule: lytic endopeptidase preproenzyme;


Added to library: Sat Jan 20 10:28:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATVQGGIEYRMPLPDGRVGLCSVGFPVTKGTIKGFATAGHCAKAGQSVQISGVNVGTFTASHFPNTDRAW
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
T

GGG


TT
GGG

TT
TT
SBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VTIGAAHTLLGSVTNYTGGSVAVKGSTEAAIGAAVCRSGRTTQYKCGTITAKNVTVNYGTLGTVSGLTRA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
TTS
SSS


B




TT
TTT
GGG
 .........150.........160.........170.........180.........190.....
Sequence NNCTGRGDSGGSWITAAGQAQGLTSGGNLPASQRQTYFERINPVLSQYGLALVTS
Predicted secondary structure





















SS confidence






















































Known secondary structure (DSSP)




TT
TT

TT
B







S
T




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D