Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mrjA_

Fold library idPDB HeaderMoleculeTitle
c5mrjA_2.70PDB header: hydrolaseChain: A: PDB Molecule: beta-xylanase;


Added to library: Sat Jan 20 10:30:05 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GTGNGELHDKFVAKGKLFFGTEIDHYHLNNQPLTNIVKSSFGQVTHENSMKWDAIEPSRGRFSWGNADAV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SSSSTT
S
GGGTT

SSSTTS
SBTTB


 .........80.........90.........100.........110.........120.........130.........140
Sequence VDFAVANGKMIRGHTLVWHSQLPDWVKQINDRNTLTQVIEDHVTAMVTRYKGKIVHWDVVNEIFSEDGNL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT


SB
SSS




TTTS
SS
B
TTSSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence RDSVFSRVLGEDFVGIAFRAARAADPNAKLYINDYNLDNANYAKVTRGMVEKVNRWVSQGVPIDGIGSQC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

STT
TTSS



TT
TTTT





 .........220.........230.........240.........250.........260.........270.........280
Sequence HLAAPGGWNPASQVPGALRALAGANVKEIAVTELDIAGAAANDYLTVMNACLQIEKCVGITVWGVSDKDS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTSSS
TTSTSS
STT

T
TTS
SBGGG
 .........290.........300.......
Sequence WRQGDNPLLFDNNYQPKAAYHALVNAL
Predicted secondary structure















SS confidence


























Known secondary structure (DSSP) TTGGG

SSB
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D