Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mrjA_

Fold library idPDB HeaderMoleculeTitle
c5mrjA_2.70PDB header: hydrolaseChain: A: PDB Molecule: beta-xylanase;


Added to library: Sat Jan 20 10:30:05 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GTGNGELHDKFVAKGKLFFGTEIDHYHLNNQPLTNIVKSSFGQVTHENSMKWDAIEPSRGRFSWGNADAV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SSSSTT
S
GGGTT

SSSTTS
SBTTB


 .........80.........90.........100.........110.........120.........130.........140
Sequence VDFAVANGKMIRGHTLVWHSQLPDWVKQINDRNTLTQVIEDHVTAMVTRYKGKIVHWDVVNEIFSEDGNL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT


SB
SSS




TTTS
SS
B
TTSSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence RDSVFSRVLGEDFVGIAFRAARAADPNAKLYINDYNLDNANYAKVTRGMVEKVNRWVSQGVPIDGIGSQC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

STT
TTSS



TT
TTTT





 .........220.........230.........240.........250.........260.........270.........280
Sequence HLAAPGGWNPASQVPGALRALAGANVKEIAVTELDIAGAAANDYLTVMNACLQIEKCVGITVWGVSDKDS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTSSS
TTSTSS
STT

T
TTS
SBGGG
 .........290.........300.......
Sequence WRQGDNPLLFDNNYQPKAAYHALVNAL
Predicted secondary structure















SS confidence


























Known secondary structure (DSSP) TTGGG

SSB
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D