Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mr4C_

Fold library idPDB HeaderMoleculeTitle
c5mr4C_2.40PDB header: signaling proteinChain: C: PDB Molecule: gdnf family receptor alpha-2;


Added to library: Sat Jan 20 10:33:26 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PPVDCVRANELCAAESNCSSRYRTLRQCLAGNKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIH
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


BTST

TSTTTT
B

TT
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGEFYEASPYEPVSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



S


TT




TS


BTTBSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S


SSTTT
T

S


BTS


SSSTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence CPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SGGG
TTTTSTT

SS

SSS


S
BSTT
GGGS
 .....
Sequence FGNGT
Predicted secondary structure



SS confidence




Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D