Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mq6A_

Fold library idPDB HeaderMoleculeTitle
c5mq6A_2.00PDB header: oxidoreductaseChain: A: PDB Molecule: pyridine nucleotide-disulfide oxidoreductase-like protein;


Added to library: Thu Feb 9 22:02:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PEDLKLHQLSQKYTAEAAKRFRPEGLGQFIRLKEVGNERFRALAEDPWVDHAALNAKEPVKDGSRYKFII
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
TTTT

TTGGGGGGG
SSGGGS
SS

TS



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGAGYGGLLYAVRLAEAGLASGPDDILMVDAAGGFGGTWWWNRYPGLHCDVESYSYMPLLEETGYIPKSK
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

STTS

STTS
SSSSTTT


TT
B
SS
STTT


SBS
 .........150.........160.........170.........180.........190.........200.........210
Sequence YAAGPELLEHAYRIATQWKLHDKALFRSNVKTIRWDDESRLWSLEVTEGRGPGQQSRELKLQARYVLLAS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
BTT
TTS
STTTT


TTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence GILTNPQVPKIPGLETFTGPVFHTARWNYDVTGGSPTDEALNRLEGKRVGIIGTGATAIQVVPKLAKYAK
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SS
SB

TTGGG

S
GGG


SBTTB


GGGTT


STT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ELYVFQRTPSGVWWRGQRPTDPVEWKTKIARKKGWQRERMLNLDSYLTDAAEEGQENMVADGWTEMPAFS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS







B

TS
STTTT


TT


SS
SGGGG
GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence AVIGSPRHGIVEPTPEKIAEHLGRLYKLDLPHAEQVRARTDSIVKDPKTAAKLKAWYPTWCKRPTFSDEY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) B
SSS



SS
SS


S
GGGS


SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LQTFNLPNVHLVDTDGKGVDAANPSGLVVADKEYPLDILVLSTGYVTPSIGGGSPAVRTGVDIYGRGGKS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTSTT
TTS


TTTT
S


BS
TTGGGG
T

GGG
B
 .........500.........510.........520.........530.........540.........550.........560
Sequence LDDKWQTHGAATLHGVCSNGFPNLFFTPLSQSSQAANNAFTLDVGTEHIVQVIKTAEDRVDGDALVEVTS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



BTTTB
TT
TT


TTS


SSTTS

 .........570.........580.........590.........600.........610.........620.........630
Sequence EAEEAWSFEIMKHAGWFASVTGCTPGYITSEGEAPMEMAKRARSGNLSQGMASYMKLLQEYRADGSLKGF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TGGGGGGGTT

SSGGGTTTT

TTTS

SB
TTS

TT
 ......
Sequence DISSRA
Predicted secondary structure

SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D