Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mm2C_

Fold library idPDB HeaderMoleculeTitle
c5mm2C_2.70PDB header: virusChain: C: PDB Molecule: capsid protein vp4a;


Added to library: Sat Dec 23 08:29:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQNPTQTMHIYDMPLRVIAGLSTLAKTTEEDDNTSTGIVVSEVGEPQVVNHPAWIDPFVAYQLRAPRKNI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)










S
TT
B
S

TTS
SSGGG

TTTTTSSS
S


TTBSS
SS





 .........80.........90.........100.........110.........120.........130.........140
Sequence TPDFIFGRADIGNAFSAFLPRRFSAPAVGTRLVVDPVFTYQQRTVLGLYNYFHADFYYIVHVPAPLGTGI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



SS


STT





SS






TT





SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence YLKIYAPEFDTTTVTRGIRFKPSASPTIALSVPWSNDLSTVETSVGRVGQSGGSIVIETIEDNSNETVNT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


SSSS


S

TTT





SSSSTTT

TT

TT



SSS
S
 .........220.........230.........240.........
Sequence PLSITVWCCMANIKATGYRHADTSAYNEKGMNFIPVPVP
Predicted secondary structure





















SS confidence






































Known secondary structure (DSSP) S













GGGS







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D