Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mm2A_

Fold library idPDB HeaderMoleculeTitle
c5mm2A_2.70PDB header: virusChain: A: PDB Molecule: capsid protein vp4c;


Added to library: Sat Dec 23 08:25:10 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLPENAPNAVSNPQQFITPATALSAEEYNVHEALGETEELELDEFPVLVFKGNVPVDSVTSIPLDLATIY
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)







SS

TTT
SS

S
SS


TT


SSSB



GGGGS

TTS


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence DFAWDGEQNAISQKFQRFAHLIPKSAGGFGPVIGNYTITANLPTGVAGRILHNCLPGDCVDLAVSRIFGL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TT

SS

TTS
SSS



TT


SSS
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KSLLGVAGTAVSAIGGPLLNGLVNTAAPILSGAAHAIGGNVVGGLADAVIDIGSNLLTPKEKEQPSANSS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
GGGSTT



SS


S







SS


S
TTS


SSSSS



SSS



SGGGS

TTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence AISGDIPISRFVEMLKYVKENYQDNPVFPTLLVEPQNFISNAMTALKTIPIEVFANMRNVKVERNLFDRT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS
SS



SSSTTTS

S



TTS
B




S

S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VVPTVKEATLADIVIPNHMYGYILRDFLQNKRAFQSGTKQNVYFQQFLTVLSQRNIRTHITLNDITSCSI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S




SSS



GGGT
STTTSTTSTS

SSSGGGGTS


 .........360....
Sequence DSESIANKIERVKH
Predicted secondary structure


SS confidence













Known secondary structure (DSSP)
S
STTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D