Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mlnB_

Fold library idPDB HeaderMoleculeTitle
c5mlnB_1.60PDB header: oxidoreductaseChain: B: PDB Molecule: alcohol dehydrogenase 3;


Added to library: Sat Dec 23 08:56:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSNALVTGGSRGIGAASAIKLAQEGYNVTLASRSVDKLNEVKAKLPIVQDGQKHYIWELDLADVEAASSF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTTSTT
S
S


STT




TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KGAPLPARSYDVFVSNAGVAAFSPTADHDDKEWQNLLAVNLSSPIALTKALLKDVSERPVDKPLQIIYIS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT
SS
GGG
S








GGG

T



TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence SVAGLHGAAQVAVYSASKAGLDGFMRSVAREVGPKGIHVNSINPGYTKTEMTAGIEALPDLPIKGWIEPE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
GGGTS

TT
GGGT
SB
SGGGTT

S



SS
S
B
 .........220.........230........
Sequence AIADAVLFLAKSKNITGTNIVVDNGLIA
Predicted secondary structure













SS confidence



























Known secondary structure (DSSP) T
SS

S
STTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D