Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mlgA_

Fold library idPDB HeaderMoleculeTitle
c5mlgA_2.60PDB header: hydrolaseChain: A: PDB Molecule: renin;


Added to library: Sat Dec 23 08:33:20 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFGRILLKKMPSVREILEERGVDMTRISAEWGEFIKSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

S


TT













SSS

TTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ANLWVPSTKCGPLYTACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

BTT

TT
GGGGGS

B
GGG
TT

SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TELPLIPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLGGSDPQ
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

TT
S


S
GGGSGGG


TT
SSSS

S
SS

SS

GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence HYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSLQLIMQALGVKEKRAN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) G
SSTTSSTT
SS

SS

S
T


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFCILALQGLDIPPPTGPVWVLGATFIRKFYTEFD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B

GGGSTT


TT
TTTS




S



TTT
S
 .........360....
Sequence RHNNRIGFALARAA
Predicted secondary structure






SS confidence













Known secondary structure (DSSP) TTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D