Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mlcL_

Fold library idPDB HeaderMoleculeTitle
c5mlcL_3.90PDB header: ribosomeChain: L: PDB Molecule: 50s ribosomal protein l13, chloroplastic;


Added to library: Thu Feb 9 11:50:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TKCTEEWRQLKEAVKKEFAIPHVPLDQRWMFTLEEATGPDIWNTTWYPKSADHVPTDKKWYVVDATDLIL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SSSS



SS

S

S


S
SSSS




TTTS
TTT



TTBB
 .........80.........90.........100.........110.........120.........130.........140
Sequence GRMASTIAIHIRGKNLASYTPSVDMGAFVIVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTTSSS

SSS





GGG
B

TT

SSSS
 .........150.........160.........170.........180.........190......
Sequence IPERIIEHAVRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPLRDKRIRVEK
Predicted secondary structure


























SS confidence























































Known secondary structure (DSSP)

TTS
TTTTTT

SSS

S

TT






SSSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D