Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mkkB_

Fold library idPDB HeaderMoleculeTitle
c5mkkB_2.70PDB header: transport proteinChain: B: PDB Molecule: multidrug resistance abc transporter atp-binding and


Added to library: Thu Feb 9 16:11:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TGRSAAPLLRRLWPYVGRYRWRYLWAVLAGLVSIFFFVLTPYFLRLAVDAVQAGRGFGVYALAIVASAAL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)
TTTTTSSSS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGLLSYAMRRLAVVASRQVEYDLRRDLLHHLLTLDRDFYHKHRVGDLMNRLNTDLSAVREMVGPGILMGS
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TT

T

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RLSFLVLLAFLSMYAVNARLAFYLTLILPGIFLAMRFLLRLIDRRYREAQEVFDRISTLAQEAFSGIRVV
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)
TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KGYALERRMVAWFQDLNRLYVEKSLALARVEGPLHALLGFLMGFAFLTVLWAGGAMVVRGELSVGELVQF
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) TT
TTTTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NAYLAQLTWPILGLGWVMALYQRGLTSLRRLFELLDEKPAIRDEDPLPLALEDLSGEVRFEGVGLKRDGR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT


SS

SS




GGG

S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence WLLRGLTLTIPEGMTLGITGRTGSGKSLLAALVPRLLDPSEGRVYVGGHEARRIPLAVLRKAVGVAPQEP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT


TTSSTTTSS

STTGGGS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence FLFSETILENIAFGLDEVDRERVEWAARLAGIHEEILAFPKGYETVLGERGITLSGGQRQRVALARALAK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


SSBGGGSSS

TT
TSTTGGG
B
SSSS



T
 .........500.........510.........520.........530.........540.........550.........560
Sequence RPKILILDDALSAVDAETEARILQGLKTVLGKQTTLLISHRTAALRHADWIIVLDGGRIVEEGTHESLLQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SSTTTTS
TT
TTS
S
GGGGTT
SBSSSSB




ST
 .........570.......
Sequence AGGLYAEMDRLQKEVEA
Predicted secondary structure




SS confidence
















Known secondary structure (DSSP) TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D