Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mkkA_

Fold library idPDB HeaderMoleculeTitle
c5mkkA_2.70PDB header: transport proteinChain: A: PDB Molecule: multidrug resistance abc transporter atp-binding and


Added to library: Fri Feb 10 00:41:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DRALFARILRYVWPYRLQVVLALLFLLVVTLAAAATPLFFKWAIDLALVPTEPRPLAERFHLLLWISLGF
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
GGGTTTS
SS


TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAVRAVHFAATYGETYLIQWVGQRVLFDLRSDLFAKLMRLHPGFYDRNPVGRLMTRVTSDVDAINQFITG
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
S
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLVGVIADLFTLVGLLGFMLFLSPKLTLVVLLVAPVLLAVTTWVRLGMRSAYREMRLRLARVNAALQENL
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP)
TTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SGVETIQLFVKEREREEKFDRLNRDLFRAWVEIIRWFALFFPVVGFLGDFAVASLVYYGGGEVVRGAVSL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTT
TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GLLVAFVDYTRQLFQPLQDLSDKFNLFQGAMASAERIFGVLDTEEELKDPEDPTPIRGFRGEVEFRDVWL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGTTS

SS


SS




S



 .........360.........370.........380.........390.........400.........410.........420
Sequence AYTPKGVEPTEKDWVLKGVSFRVRPGEKVALVGATGAGKTSVVSLIARFYDPQRGCVFLDGVDVRRYRQE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)


TT



SSS
TT

STTSSTTSS

STTGGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELRRHVGIVLQEPFLFSGTVLDNLRLFDPSVPPERVEEVARFLGAHEFILRLPKGYQTVLGERGAGLSTG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
SS



STT
TTS
T
TSTTGGG

TTT
S

 .........500.........510.........520.........530.........540.........550.........560
Sequence EKQLLALVRALLASPDILLILDEATASVDSETEKRLQEALYKAMEGRTSLIIAHRLSTIRHVDRILVFRK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT



S


TTTS



TTSST
 .........570.........580.........590...
Sequence GRLVEEGSHEELLAKGGYYAALYRLQFQEAKLG
Predicted secondary structure








SS confidence
































Known secondary structure (DSSP) T
TTST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D