Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mhfA_

Fold library idPDB HeaderMoleculeTitle
c5mhfA_2.10PDB header: hydrolaseChain: A: PDB Molecule: mannosyl-oligosaccharide glucosidase;


Added to library: Sat Dec 23 08:33:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LAWLRVRRALTLHPAPSALPPDSSSPAVAPELFWGTYRPHVYFGMKTRSPPLLTGLMWAQQGATPGTPPL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TSB

S

SS
TTTTSTTT
GGGS


TTBSSS



SS

TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence RHTCEQGDGVGPYGWEFHDGRTFGRQHIHDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQASFPLVSLFF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) B
B

TTSS

S
SSSTT

TTTT





 .........150.........160.........170.........180.........190.........200.........210
Sequence YVVTDGQEVLLPEIQLSISGHTSELGDFRLTLLPPTSPGDTVPKHGSYNVFWSSNPGLPQLTDMVKSRLN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT







TTT


B
TT

SB





GGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence SWFQHRPPGASPDRYLGLPGSLWEESGQGQFLIQQVTLKAPFSVEFVFESGSAARLVGSQLTQALESHAA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTS

S
S






S
SSTTT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AFERFETFQLEGLSPEEQALGQVALSGLLGGIGYFYGQGLVLPDTDPALFPPVPLFSGVPSRSFFPRGFL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)












T












S
TTS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence WDEGFHQLVVQRWDPHLTREALGHWLGLLNADGWIGREQILGDEARARVPPEFLVQRAAHANPPTLLLPV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT
BTTS


S

STT

GGGT
TT




TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VHLEGHDPDDLAFLRAFPRLHAWFSWLHQSQAGPVPLSYRWRGRDLALPTLLNPTLPSGLDDYPRASHPS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT



TB
SSTT
B

S





TT
S


GGGS
TT



SB

 .........500.........510.........520.........530.........540.........550.........560
Sequence TAERHLDLRCWVALGARVLSQLAEQLGETEAAAELGPLAASLEEPGSLDELHWAPELGVFADFGNHTKAV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
B
T

TTTT


S
 .........570.........580.........590.........600.........610.........620.........630
Sequence QLSRPPQGLVRVVGRPPPRLQYVDALGYVSLFPLLLQLLDPSSPRLGPLLDVLADSRHLWSPFGLRSLSA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

BTTTBS


SS





BTGGGTT
S
TT
TT
TTTTTTBSB
T
 .........640.........650.........660.........670.........680.........690.........700
Sequence SSLFYQRNTEHDPPYWRGAVWLNINYLALGALHHYGHVEGPHKVQAALYHELRANVVRNVRQQYQATGFL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSTT


SBTTB

SSSS
B
TTS
STT

S

 .........710.........720.........730......
Sequence WEQYSDQDGRGMGCRPFQGWTSLVLLIMAEEYASWS
Predicted secondary structure


















SS confidence



































Known secondary structure (DSSP)
S
TTT

SSSS
TTGGGGT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D