Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mhfA_

Fold library idPDB HeaderMoleculeTitle
c5mhfA_2.10PDB header: hydrolaseChain: A: PDB Molecule: mannosyl-oligosaccharide glucosidase;


Added to library: Sat Dec 23 08:33:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LAWLRVRRALTLHPAPSALPPDSSSPAVAPELFWGTYRPHVYFGMKTRSPPLLTGLMWAQQGATPGTPPL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TSB

S

SS
TTTTSTTT
GGGS


TTBSSS



SS

TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence RHTCEQGDGVGPYGWEFHDGRTFGRQHIHDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQASFPLVSLFF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) B
B

TTSS

S
SSSTT

TTTT





 .........150.........160.........170.........180.........190.........200.........210
Sequence YVVTDGQEVLLPEIQLSISGHTSELGDFRLTLLPPTSPGDTVPKHGSYNVFWSSNPGLPQLTDMVKSRLN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT







TTT


B
TT

SB





GGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence SWFQHRPPGASPDRYLGLPGSLWEESGQGQFLIQQVTLKAPFSVEFVFESGSAARLVGSQLTQALESHAA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTS

S
S






S
SSTTT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AFERFETFQLEGLSPEEQALGQVALSGLLGGIGYFYGQGLVLPDTDPALFPPVPLFSGVPSRSFFPRGFL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)












T












S
TTS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence WDEGFHQLVVQRWDPHLTREALGHWLGLLNADGWIGREQILGDEARARVPPEFLVQRAAHANPPTLLLPV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT
BTTS


S

STT

GGGT
TT




TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VHLEGHDPDDLAFLRAFPRLHAWFSWLHQSQAGPVPLSYRWRGRDLALPTLLNPTLPSGLDDYPRASHPS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT



TB
SSTT
B

S





TT
S


GGGS
TT



SB

 .........500.........510.........520.........530.........540.........550.........560
Sequence TAERHLDLRCWVALGARVLSQLAEQLGETEAAAELGPLAASLEEPGSLDELHWAPELGVFADFGNHTKAV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
B
T

TTTT


S
 .........570.........580.........590.........600.........610.........620.........630
Sequence QLSRPPQGLVRVVGRPPPRLQYVDALGYVSLFPLLLQLLDPSSPRLGPLLDVLADSRHLWSPFGLRSLSA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

BTTTBS


SS





BTGGGTT
S
TT
TT
TTTTTTBSB
T
 .........640.........650.........660.........670.........680.........690.........700
Sequence SSLFYQRNTEHDPPYWRGAVWLNINYLALGALHHYGHVEGPHKVQAALYHELRANVVRNVRQQYQATGFL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSTT


SBTTB

SSSS
B
TTS
STT

S

 .........710.........720.........730......
Sequence WEQYSDQDGRGMGCRPFQGWTSLVLLIMAEEYASWS
Predicted secondary structure


















SS confidence



































Known secondary structure (DSSP)
S
TTT

SSSS
TTGGGGT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D