Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mg5R_

Fold library idPDB HeaderMoleculeTitle
c5mg5R_3.44PDB header: transferaseChain: R: PDB Molecule: 2,4-diacetylphloroglucinol biosynthesis protein phlc;


Added to library: Sat Dec 23 09:04:50 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RRVAIVSAAYTPKPGSSRVRQTFKEMIVESAYKALKDAKMHPREIQAVAYGYHGEGISEYGGLGPTISDA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S
TTS

TTS
T

GGG


S
TTTTS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGISPAPTFMSTANTSSSVSFQMGHQMVASGEYDIVLCGGFEKMTDHFNYAEYIGSSTECEYDYFLGISH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
TTS




TTS
S
GGGSTTTTSS
GGGTGGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence TDAFALATAEYFQKFGYAGREADVLATFGRQMRIYAQNTPTATRYGQPIPSLEVLKNSEACGSMLAWGEA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
TT
T
TTSTTTT




SGGGGT


B

 .........220.........230.........240.........250.........260.........270.........280
Sequence SGCAILVAEHLAHKYTDKPVFVRGCAYTGVSHYFGTRFHNPTLHHPGLPKDVGMAVSANSIACAEIAYKK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT
SS


S
GGGGT

TT


TT

SS
SSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AGITAKDIDVAQVYDLLGAGLIQMESMGICGKGQAGDFVLEGGIALDGQLPLNTDGGNIGRGHASGCDGI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

STT
S

STTTTSS
TT
TTTTSTTSSS
B
TT
T
B
TTT
 .........360.........370.........380.........390....
Sequence LHITELFRQLRGESDNQVKGARIGVSQNLGGYAAHNSVIVLSND
Predicted secondary structure

















SS confidence











































Known secondary structure (DSSP) TT

SS

TT

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D