Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mg5R_

Fold library idPDB HeaderMoleculeTitle
c5mg5R_3.44PDB header: transferaseChain: R: PDB Molecule: 2,4-diacetylphloroglucinol biosynthesis protein phlc;


Added to library: Sat Dec 23 09:04:50 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RRVAIVSAAYTPKPGSSRVRQTFKEMIVESAYKALKDAKMHPREIQAVAYGYHGEGISEYGGLGPTISDA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S
TTS

TTS
T

GGG


S
TTTTS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGISPAPTFMSTANTSSSVSFQMGHQMVASGEYDIVLCGGFEKMTDHFNYAEYIGSSTECEYDYFLGISH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
TTS




TTS
S
GGGSTTTTSS
GGGTGGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence TDAFALATAEYFQKFGYAGREADVLATFGRQMRIYAQNTPTATRYGQPIPSLEVLKNSEACGSMLAWGEA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
TT
T
TTSTTTT




SGGGGT


B

 .........220.........230.........240.........250.........260.........270.........280
Sequence SGCAILVAEHLAHKYTDKPVFVRGCAYTGVSHYFGTRFHNPTLHHPGLPKDVGMAVSANSIACAEIAYKK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT
SS


S
GGGGT

TT


TT

SS
SSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AGITAKDIDVAQVYDLLGAGLIQMESMGICGKGQAGDFVLEGGIALDGQLPLNTDGGNIGRGHASGCDGI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

STT
S

STTTTSS
TT
TTTTSTTSSS
B
TT
T
B
TTT
 .........360.........370.........380.........390....
Sequence LHITELFRQLRGESDNQVKGARIGVSQNLGGYAAHNSVIVLSND
Predicted secondary structure

















SS confidence











































Known secondary structure (DSSP) TT

SS

TT

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D