Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mg5P_

Fold library idPDB HeaderMoleculeTitle
c5mg5P_3.44PDB header: transferaseChain: P: PDB Molecule: hydroxymethylglutaryl-coa synthase;


Added to library: Sat Dec 23 08:32:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KIGIVSYGAGIPVCRLKVQEVINVWKNTDLKLVEENLGVTERAVLQPDEDVITLGVLAAQRALDKVPGHQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



S

S
TTS

S

TT

TTSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence IEALYLGTCTNPYDSRASASIILEMLGSGYDAYCADVQFAGKSGTSALQICQALVASGMTGSALAIGADT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS
S
SSS

S
SSS

GGGTTS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence INRNTAPGDLTESYAGAGAAALLIGSQDVIAEFDASFSCAADVADNIRPQGDRYIRSGMGLGSDKNSIGL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTTS
TT
TTGGGB
SSS
S



S

TT

S
SS
SST
 .........220.........230.........240.........250.........260.........270.........280
Sequence EDQTRRAAEGLMAKLHTSPADYDYVVFQQNLVSTPYSLAKHLGFNPKQVEPGIYAGNVGDAGSASPLLGL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

GGG
S

SSST

GGG

GGGT
B
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence INVLDQARPGQKILLVSYGFGAGSDAIALTVTDAIEQYQKHNKPLRELLESKIYVDYGTSIKYEFKYLRA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

TT
TTT
TTT


TT



TT
S


 ........
Sequence DYALTAYL
Predicted secondary structure







SS confidence







Known secondary structure (DSSP) SS
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D