Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mg5P_

Fold library idPDB HeaderMoleculeTitle
c5mg5P_3.44PDB header: transferaseChain: P: PDB Molecule: hydroxymethylglutaryl-coa synthase;


Added to library: Sat Dec 23 08:32:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KIGIVSYGAGIPVCRLKVQEVINVWKNTDLKLVEENLGVTERAVLQPDEDVITLGVLAAQRALDKVPGHQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



S

S
TTS

S

TT

TTSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence IEALYLGTCTNPYDSRASASIILEMLGSGYDAYCADVQFAGKSGTSALQICQALVASGMTGSALAIGADT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS
S
SSS

S
SSS

GGGTTS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence INRNTAPGDLTESYAGAGAAALLIGSQDVIAEFDASFSCAADVADNIRPQGDRYIRSGMGLGSDKNSIGL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTTS
TT
TTGGGB
SSS
S



S

TT

S
SS
SST
 .........220.........230.........240.........250.........260.........270.........280
Sequence EDQTRRAAEGLMAKLHTSPADYDYVVFQQNLVSTPYSLAKHLGFNPKQVEPGIYAGNVGDAGSASPLLGL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

GGG
S

SSST

GGG

GGGT
B
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence INVLDQARPGQKILLVSYGFGAGSDAIALTVTDAIEQYQKHNKPLRELLESKIYVDYGTSIKYEFKYLRA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

TT
TTT
TTT


TT



TT
S


 ........
Sequence DYALTAYL
Predicted secondary structure







SS confidence







Known secondary structure (DSSP) SS
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D