Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5me3B_

Fold library idPDB HeaderMoleculeTitle
c5me3B_2.85PDB header: cell cycleChain: B: PDB Molecule: sister chromatid cohesion protein 2;


Added to library: Thu Feb 9 15:07:50 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NLHITHFSYIMLSILQVWNNYDYCSNLVSPDTEQLHDLIAHHAATQSDLEFAADHIIDTILKKCFSNISK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)




TT




S

TSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YRFVFDQFVTDMTTVVTLPDWPVSDLILARLLKKLLSIFNKHINIESVALQGIGLIGSTILDIRLSSNPT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT
TT
TTTT



T


 .........150.........160.........170.........180.........190.........200.........210
Sequence ANLIHLFNYPEDIDGLFKAYRTCLAYCTNSVQHHTPYKFLWCKQLDVLTKLKEMDKESQGWGSKLQQKFL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

S
TS
SSGGGSS
STTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLIESIAVEILPTYCSTLLTSELINMYEPYLKLVLSLLERHKVKLRSGAIRCLALLISKDKNMLYTPIVK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T

TTTTTSTGGG
S

GGGGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ETIENRLTDSSPLVKDAILELIELGSSYIDFYQHININYNDDSMLVRKHVLRMNQIIYDDTEDIIIKAYV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS
TSS

GGGGGGTT
S



 .........360.........370.........380.........390.........400.........410.........420
Sequence ASRILRRIEDEEDVIIETARSELLKRWILSIQCPNAKPELQIKNCRVSIRVIAQLLVGGDKICDLFEHFL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS
SSTGGGG
SSS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence IFYVLNKNAHTEDQNKLISSSLCLLTDQVIEMVIENEAEEGRNIMKFLSVLSSCQDSFITKDHITALYPY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTT
TTSS



TSTT



GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence LKSDFQLHILKVYRNTFEQLSHFKPKFLYDLETTILSRLPRMNVRELDEAIPLSWSLSRHRKDDTRICKA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TTTT




STTS
T

 .........570.........580.........590.........600.........610.........620.........630
Sequence CASCLGQLSPYIANATTDPRPDGKLQRLLYLATGFARFCSNIFEYVTKCLLMFTKENIHHVIRRIATKNL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S




T


T
STTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence VKIASRYPKLFNSRHVLTVLDTQFEKGILDIQLVVLESLYDFFLAEERRSINDGICSALVSRYLDKILKI
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
GGGGG






 .........710.........720.........730.........740.........750.........760.........770
Sequence CLIADLNNAMVAIRFLKQILTYGYTNPSLCVPTVIALTASPNSYMRDLSSEMFSELLQGYESMAFNCLNQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TSS
T
S
GGGTTT
SSST
 .........780.........790.........800.........810.........820.........830.........840
Sequence GIRLGTEYAVKIRPKQFHEDSMFLRRLQQLMSTNKRNRSKFLKVVKKTVFSNYLSTSVNYEESCYHIIYL
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTTGGG




STSSTT

 .........850.........860.........870.........880.........890.........900.........910
Sequence LHNLSKISYDNMLELYEMLRSVISVSEYFSDRISERLDGFQSNQNTAAEVSAIIVTRLSIEEFKRFMFEQ
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SS

TT
S

SGGGGG
 .........920.........930.........940.........950.........960
Sequence HHEAKLTLLDRNKSVAALDDQVGSLHMENIFLGYENPINNKDYCWKYIST
Predicted secondary structure



















SS confidence

















































Known secondary structure (DSSP)




TTS



S



STT
S

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D