Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mbxA_

Fold library idPDB HeaderMoleculeTitle
c5mbxA_1.40PDB header: oxidoreductaseChain: A: PDB Molecule: peroxisomal n(1)-acetyl-spermine/spermidine oxidase;


Added to library: Thu Feb 9 21:02:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPRVLVVGSGIAGLGAAQKLCSAPHLRVLEATASAGGRIRSERCFGGVVELGAHWIHGPSQDNPVFQLAA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



B



SSSSSBTT

TTSS


BSS
STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EFGLLGEKELSEENQLVSMIWSSSGTSVSLELMTEMARLFYGLIERTREFLNESETPMASVGEFLKKEIS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


S

TTS
B

GGGGTT
SS
SSSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence QQVASWTRKRKLAILNTFFNIECCVSGTHSMDLVALAPFGEYTVLPGLDCILAGGYQGLTDRILASLPKD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

T
S
GGGBBTTTGGGS


SS

B

TT
TS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TVAFDKPVKTIHWNGSFQEAAFPGETFPVLVECEDGARLPAHHVIVTVPLGFLKEHQDTFFEPPLPAKKA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SS


SS

SSSS

STT

S


S


 .........290.........300.........310.........320.........330.........340.........350
Sequence EAIKKLGFGTNNKIFLEFEEPFWEPDCQFIQVVWEDTSPLQDTALSLQDTWFKKLIGFLVQPSHVLCGFI
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
SS

S
TT


TT

TTT

TT


SSGGGG




 .........360.........370.........380.........390.........400.........410.........420
Sequence AGLESEFMETLSDEEVLLSLTQVLRRVTGNPQLPAAKSVRRSQWHSAPYTRGSYSYVAVGSTGDDLDLMA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS
TT
TT



S

TTT
TTTSSS
BTT

 .........430.........440.........450.........460.........470..
Sequence QPLPGLQVLFAGEATHRTFYSTTHGALLSGWREADRLVSLWDSQVEQSRPRL
Predicted secondary structure





















SS confidence



















































Known secondary structure (DSSP)


GGGS
SGGG
TTTTTSGGGGG




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D