Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mabA_

Fold library idPDB HeaderMoleculeTitle
c5mabA_2.44PDB header: electron transportChain: A: PDB Molecule: foxe;


Added to library: Sat Dec 23 08:28:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTRTLSQQYLDDVRSGAIVIEGDSAAVSELILKRDIPIPYSYIAQLFATPNAFGSGPACIICHGSNNPTH
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



T




STTTTTTT



STTTTSSS

SB
S
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYRGLNLSTCDGLRNGSTEQPARAIFTPGEDPKNAIIGRRLRANRMPLGIAFNNPTDSAPILAIKEWILA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SGGGBBTTS
B
SSS
B
S

TTS
GGGS


SSTT

TTS
SS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GAPNDEHFTKEILPLFATDNTFGPDTPHCTTCHFSNQEPPSFHELNLTTYEGIMLGADSVAKGVDNATKV
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) T


STGGGGTSTTSSSTT


GGGT
B
SSTTTSGGG
B
SS
BSTTTT
SSSSB

 .........220.........230.........240.........250.........
Sequence IIPGDPEASKVFQHLTEDRMPPGIDPSEDRDHPNTQILFAWIKQGAKCE
Predicted secondary structure

























SS confidence
















































Known secondary structure (DSSP)

TT
GGG



SSTT

TTS
TT
TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D