Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mabA_

Fold library idPDB HeaderMoleculeTitle
c5mabA_2.44PDB header: electron transportChain: A: PDB Molecule: foxe;


Added to library: Sat Dec 23 08:28:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTRTLSQQYLDDVRSGAIVIEGDSAAVSELILKRDIPIPYSYIAQLFATPNAFGSGPACIICHGSNNPTH
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



T




STTTTTTT



STTTTSSS

SB
S
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYRGLNLSTCDGLRNGSTEQPARAIFTPGEDPKNAIIGRRLRANRMPLGIAFNNPTDSAPILAIKEWILA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SGGGBBTTS
B
SSS
B
S

TTS
GGGS


SSTT

TTS
SS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GAPNDEHFTKEILPLFATDNTFGPDTPHCTTCHFSNQEPPSFHELNLTTYEGIMLGADSVAKGVDNATKV
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) T


STGGGGTSTTSSSTT


GGGT
B
SSTTTSGGG
B
SS
BSTTTT
SSSSB

 .........220.........230.........240.........250.........
Sequence IIPGDPEASKVFQHLTEDRMPPGIDPSEDRDHPNTQILFAWIKQGAKCE
Predicted secondary structure

























SS confidence
















































Known secondary structure (DSSP)

TT
GGG



SSTT

TTS
TT
TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D