Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m6pB_

Fold library idPDB HeaderMoleculeTitle
c5m6pB_2.60PDB header: isomeraseChain: B: PDB Molecule: tyrocidine synthase 2;


Added to library: Sat Dec 23 09:45:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RESEQGVVEGEIALTPIQKWFFANNFTDRHHWNQAVMLFREDGFDEGLVRQAFQQIVEHHDALRMVYKQE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




S





TT
TTTT
B
TT


SGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGAIKQINRGLTDERFRFYSYDLKNHANSEARILELSDQIQSSIDLEHGPLVHVALFATKDGDHLLVAIH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT

SSS
S

SSSS
TT


SSSS
S
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence HLVVDGVSWRILFEDFSSAYSQALHQQEIVLPKKTDSFKDWAAQLQKYADSDELLREVAYWHNLETTTTT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGG

TT








S
TSSSSTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence AALPTDFVTADRKQKHTRTLSFALTVPQTENLLRHVHHAYHTEMNDLLLTALGLAVKDWAHTNGVVINLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)




S


S

BGGG

STTGGGTT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GHGREDIQNEMNVTRTIGWFTSQYPVVLDMEKAEDLPYQIKQTKENLRRIPKKGIGYEILRTLTTSQLQP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)





STT


TT

S



S

S
TSGGGGTT

S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PLAFTLRPEISFNYLGQFESDGKTGGFTFSPLGTGQLFSPESERVFLLDISAMIEDGELRISVGYSRLQY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)







S


TTTTS

SS




B
TT
B

SSTTTTT
 .........430.........440.......
Sequence EEKTIASLADSYRKHLLGIIEHCMAKE
Predicted secondary structure




SS confidence


























Known secondary structure (DSSP)
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D