Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m6pB_

Fold library idPDB HeaderMoleculeTitle
c5m6pB_2.60PDB header: isomeraseChain: B: PDB Molecule: tyrocidine synthase 2;


Added to library: Sat Dec 23 09:45:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RESEQGVVEGEIALTPIQKWFFANNFTDRHHWNQAVMLFREDGFDEGLVRQAFQQIVEHHDALRMVYKQE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




S





TT
TTTT
B
TT


SGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGAIKQINRGLTDERFRFYSYDLKNHANSEARILELSDQIQSSIDLEHGPLVHVALFATKDGDHLLVAIH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT

SSS
S

SSSS
TT


SSSS
S
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence HLVVDGVSWRILFEDFSSAYSQALHQQEIVLPKKTDSFKDWAAQLQKYADSDELLREVAYWHNLETTTTT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGG

TT








S
TSSSSTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence AALPTDFVTADRKQKHTRTLSFALTVPQTENLLRHVHHAYHTEMNDLLLTALGLAVKDWAHTNGVVINLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)




S


S

BGGG

STTGGGTT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GHGREDIQNEMNVTRTIGWFTSQYPVVLDMEKAEDLPYQIKQTKENLRRIPKKGIGYEILRTLTTSQLQP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)





STT


TT

S



S

S
TSGGGGTT

S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PLAFTLRPEISFNYLGQFESDGKTGGFTFSPLGTGQLFSPESERVFLLDISAMIEDGELRISVGYSRLQY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)







S


TTTTS

SS




B
TT
B

SSTTTTT
 .........430.........440.......
Sequence EEKTIASLADSYRKHLLGIIEHCMAKE
Predicted secondary structure




SS confidence


























Known secondary structure (DSSP)
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D