Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m59C_

Fold library idPDB HeaderMoleculeTitle
c5m59C_3.20PDB header: splicingChain: C: PDB Molecule: pre-mrna splicing helicase-like protein;


Added to library: Thu Feb 9 20:51:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VGGLQPKKLVNLENLVFDQGNHLMTNPRVRMPEGTTKRVFKGYEEIHVPPPKKRSDPTDQNIPVTELPEW
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)










S
TT
TT



S




TT
TT




SS
TT



BGGGS
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ARIPFNTTKTLNKIQSKCFPTAFLDDGNMLVCAPTGSGKTNVAMLTMLREIGKNRNEKGEIDLDAFKIVY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GSSS

S
SB

TTS

S



TTS
T

SSS



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IAPLKALVQEQVGNFGKRLEPYGIKVSELTGDRQLTKQQISETQVIVTTPEKWDVITRKATDISYTNLVR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSSGGGT



B

TTTTTTT
SS

TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LIIIDEIHLLHDDRGPVLESIVSRTIRRTEQTGEPVRIIGLSATLPNYRDVASFLRVDFEKGLFYFDGSY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TGGGGGSTTTTT




S
S
TT

TTTT

GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence RPCPLRQEFIGVTDKKAIKQLKTMNDITYQKVLEHVGQNRNQMLIFVHSRKETAKTAKYIRDKALEMDTI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSS



STTTTS



S
TTTTT

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence NQILKHDAGTREVLQEAASSVNNTDLKDLLPYGFGIHHAGMSRADRTDVEDLFASGHIQVLVCTATLAWG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
SSTTTTTS

S
GGGTTTT
TTS
T

S
TS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VNLPAHTVIIKGTQVYSPEKGSWVELSPQDVLQMLGRAGRPQYDTYGEGIIITTQGEIPYYLSLLNQQLP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S



S

TTTT

S
S
TTT
S
GGGTTT
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence IESQLVSKLVDSLNAEIVLGNVRNRDEGVEWLGYTYLFVRMLRSPGLYSVGAEYEDDVALEQKRVDLIHS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)



TTTSTTS

BTTS
TTTTT

STTSS
SSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence AAMVLKKSNLIKYDEKTGKMQATELGRIASHYYISHESMDTYNKLIHPAMNDVELFRVFAQSGEFKYIPV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTS
TTT
B
TT



TT

T
TTSTT


 .........640.........650.........660.........670.........680.........690.........700
Sequence RQEEKLELAKLLARVPIPVKESIEEPTAKINVLLQAYISRLKLEGLALMADMVYVTQSAGRILRAIFEIC
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
GGGTS
SS

TTS
SST




 .........710.........720.........730.........740.........750.........760.........770
Sequence LKKGWASVAKLALNMCKMAEKRMWPTMSPLRQYPTCPAEIIKKAERMDVPWSSYFDLDPPRMGELLGMPK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTBTS
TTS
GGGG
TTS
TTS


GGGGSS

TTTT
SS
 .........780.........790.........800.........810.........820.........830.........840
Sequence AGKTVCALVSKFPRVEIQGNVQPMTRSMLRIELTITPNFQWDVELHGVTESFWILVEDCDGEEILFHDVF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S



SSS
S



S
SSS
B
 .........850.........860.........870.........880.........890.........900.........910
Sequence ILRKDLAEAEENEHTVEFTVPISEPMPPNYFISVISDRWMHSETRMPVSFQKLILPERFPPHTELLDLQP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SS




SS

SSSSTT

SS

















 .........920.........930.........940.........950.........960.........970.........980
Sequence LPVSALKAKDYAALYPNWQQFNKIQTQTFNSLYNTDNNVLVAAPTGSGKTVCAEFALLRHWAKKDAGRAV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
BGGGGS
SSGGGSSSS
SB

TTTTTTSS

S



TTSS
TTTSSS


 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence YIAPFQELVDLRFQDWQKRLSHLRGGKEIVKLTGETTTDLKLLEQGDLILATPLQWDVLSRQWKRRKNVQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSTTTTT


SS




S
SS
TTTTSS
TT
SSSS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence TVELFIADDLHMLGGQMGYIYEIVVSRMHFIRTQTELPMRIVGLSVSLANARDIGEWIDAKKHDIYNFSP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TGGGGGSTT




S
BS

T

GGG

T
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence HVRPVPLELHIQSYTIPHFPSLMLAMAKPTYLAITQLSPDQPAIVFVPSRKQTRATARDLLTACLADDDE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

SS


S

SSS
BSSSTT
T
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence DRFLHVEVDQIRKLLDHVQEEALAEALSHGVGYYHEALSQSDKRIVKHLYNNGAIQVLIASRDVCWELDF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTB
S
GGGTGGGSTTSS
TTT


TTS
TTSBSBGGGTTT


 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence TAHLVVVMGTQFFEGKEHRYIDYPLSEVLQMFGKALQPSKDGRSRGVLMLPAVKREYYKKFLNEALPVES
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
STTTT

GGG




SSS
GGGTTS
B



 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence HLHNFLPDAFVTEISTKMIESGEDAINWATFTYFYRRLLANPSYYGLQDPTHDGLSQYLSDLVETTLKQL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTTSTTTTSSSSSTSST



S
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence SDARIIEMDEDEGTVAPLNAAMIAAYYNISYMTMEMFLLSLSHKSKLRTILEIVTAATEFESIQTRRHEE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSS



SSS





T

S

SS

STT
GGGTTS


GGG
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence GILKRIYDHVPVNPVWDSAHFKAFVLVQAHFSRMNLPIDLAKDQEVILQKILSLLSAIVDILSSEGALNA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TS




TTST



TTTTTTSS



 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence MEMSQMVVQAMWDRDSPLKQIPNFTPEVVKVANKYGINDIFDFMEQMNPEENPNYASLVKDLGLTQAQLA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

SS

GGGGSSS

TTTT
SSTTSSS
S
STTTSS

TTT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence QAANFTNNKYPDITLEFDNIRAHIERELEEDEEPTVHAPFYPGNWWLVVGEESTKTLLAIVKLEFVVPSP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTS








S







SSS






SSS







B


TT













S
 .........1690.........1700..
Sequence GKHDLKLFLMSDSYVGVDQDPS
Predicted secondary structure










SS confidence





















Known secondary structure (DSSP) S




B



SS
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D