Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m3fA_

Fold library idPDB HeaderMoleculeTitle
c5m3fA_3.80PDB header: transcriptionChain: A: PDB Molecule: dna-directed rna polymerase i subunit rpa190;


Added to library: Thu Feb 9 11:27:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEK
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

TTS













S
B





B
TT
SB
TTSTT
TTTS
BTTB

TTT


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEIT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T





TTSSTTB
TTT
SBSS
TTTT

GGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence LSSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFSPK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTT

TT



TTTTTT

S
SSS





 .........220.........230.........240.........250.........260.........270.........280
Sequence FRKDGFTKIFETALNEKQITNNRVKGSTYILSTEVKNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SSS









ST
SS

SS




GGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRRVIFSRLMN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGGS

TT

S
TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEI
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
GGGS

STT
S




SSSSSTTTTTTTSS


SS
SSS
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



STT
TTSSS

TT


TT

TS


 .........500.........510.........520.........530.........540.........550.........560
Sequence SNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNM
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) SSSTTTT




TT

SS

SGGG
SS
SS
STT


SSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence HFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


SSSBGGG

B
SSSS
B




TTSSTT

TT
TTST
 .........640.........650.........660.........670.........680.........690.........700
Sequence HTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) T
SSSS





SB
SSS
BTS
TTS




S


TT

TTTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence LLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTD
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)



SS
SSSS





STTS
B
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence ILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDG
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) GGGSST

TT

TT

TTTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence TMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) BSS
TTT
T
SS

T

B


BTTBSS


TTS
SSTTS
SS

SSGGGT
B

B
 .........920.........930.........940.........950.........960.........970.........980
Sequence FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGGDAI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTB

STT

TTSS
TTS
SSSSSS
B
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence DITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKYDPVLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSS
TTTT
TT
GGGTSSSSB
SS
SS
TTTS

SS

 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence KYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S
TTTBTT


TGGGGTSSSS

TB

TT

TTTTT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence PSTQMANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTERSY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGGG





STT

SS
SS
B
SSS
SSSSS
GGGS

 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence VIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKKVQRDRQSAIISHHRFITKYNFD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TT


T


SS
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence DESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSS



SS





TT


TT






GGG

S

TT
T
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence AFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGM
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTB
SSS
S
ST
TT



GGGSS


SS
 .........1410.........1420.........1430.........1440.........1450.........
Sequence ETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPN
Predicted secondary structure






























SS confidence


























































Known secondary structure (DSSP) TT
S
TTS
TTT



STTTTTTTT


TTTTSSS








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D