Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m3cB_

Fold library idPDB HeaderMoleculeTitle
c5m3cB_2.80PDB header: hydrolaseChain: B: PDB Molecule: diguanylate cyclase;


Added to library: Sat Dec 23 13:02:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHDPLTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAERLRDQLR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
B
TTT

B
T

S
TS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQADGHEFFVSASVGIALFPKDGDDAPTLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSSTT


S
TTTS
TT

TTT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRRALERDELQLYYQPKLSLESGLLVGAEALV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S
SS


TTTT

TTTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RWYHPLFGEISPERFIPLAEDCGLILPLGDWVLEHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIER
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTT
TT
B







TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LEQLLEQSGLEPSRLQLEITESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

GGGTT

T
SSS


S


 .........360.........370.........380.........390.........400.........410.........420
Sequence DKSFIRGLPDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAELFAS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTTTT
TT




STT

STTT


 ......
Sequence KFLKPR
Predicted secondary structure


SS confidence





Known secondary structure (DSSP)

B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D