Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m11A_

Fold library idPDB HeaderMoleculeTitle
c5m11A_2.90PDB header: transport proteinChain: A: PDB Molecule: immunoreactive 84kd antigen pg93;


Added to library: Thu Feb 9 12:52:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GIWNTLLAIHKTEKAVETPKKVFAVANGVLYSVGKEAPHEAKIFDRISGLSDTSVSSIAYSEQLKSLVIY
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





S
SSBTT
BSSSS



GGGT
S
S
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YASGNIDILDEAGRVTNVPALKDNIDLIDKTLNRLLIVGNRAYLAGGFGLSVLDVAEARIPATYAKGTKV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTS

TTS


SS




TTTTTTTTTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TDVAKLDNDRLLMLKEGQLFIGKETDNLQDPAAWTALSLNLPMGSVTGLGIVGEDICFLLADGRVYVAAN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
STTTTTTS
TTSGGGS

SS
GGGTTTTST
 .........220.........230.........240.........250.........260.........270.........280
Sequence QSFEPELLLSSSADSRLYVTDRGLFICAENRIYFIEKGRKTTQFPIADVLGVGAMNESNTAYIALGEEGL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT




SS

SS

SS
TTT


S



TT
S
BTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ASLLLAEGSTAEAMPVAFDGPGDNDFYEMRFSHGRLYAASGLWGTNLMGHAGMVKLYDGNRWTNFDKKTV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSTT










SSS

STT



SSS



B

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QEQLGGGFSFNDAIDIAVSNGDPDHFFVGTWGNGLFEFKDGKAIARYSGNETAIAECNPGDARVKAIAFD
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SS


B

SS
TT
BTT
STTSS


SBTTB
 .........430.........440.........450.........460.........470.........480.........490
Sequence NKGNLWGTLGAVGKNIFMYDPQSSTWHSFSYPDVANLASFGNMIILPNGDKWVNILHRSGGSTRKGVLIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTS
SSSSS
TTTT

TTTTT
S
TTS
SSTT




 .........500.........510.........520.........530.........540.........550.........560
Sequence NDRGTPETTSDDSHLYVEQFVNRLGAAIGHKTIYAMAVDHNGSVWMGSDIGIFGVYNAAGVLSSTSTPIA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
TT
TT
STT
SS
B
TTS
B


S

TTS
TTSSGGGTTT
SS

B
 .........570.........580.........590.........600.........610.........620.........630
Sequence VRPVGGEEPNLYYVLDKVTVTDIVVDKLNHKWVATQGTGLYLLSEDCSKILAQFTVENSPLLSNNILSLA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S
TTS
TTTT

TTS
SS

TTS
S
TTTSS
S
SB
 .........640.........650.........660.........670.........680.........690.........700
Sequence LNDDNGLLYIGTADGLMTFQTGTGSGSASELDGVYVYPNPLRPEYPDGVTIAGLQAGCSVKITDTTGRLL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTT
S




TTSSTT
SSSB
TT

S
S

TT

SS

 .........710.........720.........730.........740........
Sequence YQTESVTTEVKWNARGADGNRVASGVYAVAVYDPVSKKSKLIRFAVIR
Predicted secondary structure
















SS confidence















































Known secondary structure (DSSP)
SSS


B
TTSSB

S
TTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D