Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5m0tA_

Fold library idPDB HeaderMoleculeTitle
c5m0tA_2.20PDB header: oxidoreductaseChain: A: PDB Molecule: alpha-ketoglutarate-dependent non-heme iron oxygenase eash;


Added to library: Thu Feb 9 15:41:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKPTLRRIPRSAGDEAIFQVLQEDGVVVIEGFMSADQVRRFNGEIDPHMKQWELGQKSYQESYLAGMRQL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





GGG
STSS
GGG

B

S


STTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SSLPLFSKLFRDELMNDELLHGLCKRLFGPESGDYWLTTSSVLETEPGYHGQELHREHDGIPICTTLGRQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTTT
TGGG
TTTTB


TT





B
GGGGSGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SPESMLNFLTALTDFTAENGATRVLPGSHLWEDFSAPPPKADTAIPAVMNPGDAVLFTGKTLHGAGKNNT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S


SS
B
TTTT


TTGGG
S
TTS



GGGS

B
TT
TTS






 .........220.........230.........240.........250.........260.........270.........280
Sequence TDFLRRGFPLIMQSCQFTPVEASVALPRELVETMTPLAQKMVGWRTVSAKGVDIWTYDLKDLATGIDLKS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SS

TTS

SS
GGGS
TTS
TT
S
TTS
BTTB
TT


 .......
Sequence NQVAKKA
Predicted secondary structure






SS confidence






Known secondary structure (DSSP) S






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D