Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lyeA_

Fold library idPDB HeaderMoleculeTitle
c5lyeA_1.90PDB header: structural proteinChain: A: PDB Molecule: gp12;


Added to library: Sat Jan 20 08:44:15 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATESVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNVFETPYTFMNSTATEEYKGVIKLGTQSEVNSN
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

SSS




B

STT

SSB

TTTTT


TTTTS


SS





B

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIHQRGGQTINGTLRINNTLTIA
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
SSSB

SB

SSS

B
SSTT

BTTBSS
TTSS


SS




SS



SS




 .........150.........160.........170.........180.........190.........200.........210
Sequence SGGANITGTVNMTGGYIQGKRVVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRI
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) SS



SS



S

TT


GGGS
TT

SSS
S
TTSBS
B

TTT
 .........220.........230......
Sequence GTRYGGSSSNPGLPDMRLNYIIKVKE
Predicted secondary structure















SS confidence

























Known secondary structure (DSSP) TTTTSB
SSSBB

B






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D