Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5luqB_

Fold library idPDB HeaderMoleculeTitle
c5luqB_4.30PDB header: transferaseChain: B: PDB Molecule: dna-dependent protein kinase catalytic subunit,dna-


Added to library: Thu Feb 23 10:30:47 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFSRDFGLLVFVRKSLNSIEFR
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TTTTTT

TT

SSTTS
STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ECREEILKFLCIFLEKXGQKIAPYSVEIKNTCTSVYTKDRAAKCKIPALDLLIKLLQTFRSSRLXDEFKI
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
S


TTSS
SSSS





S
 .........150.........160.........170.........180.........190.........200.........210
Sequence GELFSKFYGELALKKKIPDTVLEKVYELLGLLGEVHPSEXINNAENLFRAFLGELKTQXTSAVREPKLPV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS



STTS

TTTT
SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence LAGCLKGLSSLLCNFTKSXEEDPQTSREIFNFVLKAIRPQIDLKRYAVPSAGLRLFALHASQFSTCLLDN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


SSTT

S
TTTTTTTSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence YVSLFEVLLKWCAHTNVELKKAALSALESFLKQVSNXVAKNAEXHKNKLQYFXEQFYGIIRNVDSNNKEL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S

TTSS
SSTTGGGTS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence SIAIRGYGLFAGPCKVINAKDVDFXYVELIQRCKQXFLTQTDTGDDRVYQXPSFLQSVASVLLYLDTVPE
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) GGGGS

SGGGS




TTTTTTS





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence VYTPVLEHLVVXQIDSFPQYSPKXQLVCCRAIVKVFLALAAKGPVLRNCISTVVHQGLIRICSKPVVLSE
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TS
SSS
S
SST
S
S


 .........500.........510.........520.........530.........540.........550.........560
Sequence SEDHRASGEVRTKDYVDLFRHLLSSDQXXDSILADEAFFSVNSSSESLNHLLYDEFVKSVLKIVEKLDLT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T



TTTTSS
SSTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence LEIQTVGEQENGDEAPGVWXIPTSDPAANLHPAKPKDFSAFINLVEFCREILPEKQAEFFEPWVYSFSYE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TTTTS




SSTTTTSS
STTTTTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LILQSTRLPLISGFYKLLSITVRNAKKIKYKYSCFALFVKFGKEVAVKXKQYKDELLASCLTFLLSLPHN
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)
TTSS
TT




 .........710.........720.........730.........740.........750.........760.........770
Sequence IIELDVRAYVPALQXAFKLGLSYTPLAEVGLNALEEWSIYIDRHVXQPYYKDILPCLDGYLKTSALSDET
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TTT

S
STTTTSTTSTTTTTTT
TT

TTTTTTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence ISLEEIRIRVVQXLGSLGGQINKNLLTVTSSDEXXKSYVAWDREKRLSFAVPFREXKPVIFLDVFLPRVT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTSST







S
SS



SSS





TTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence ELALTASDRQTKVAACELLHSXVXFXLGKATQXPEGGQGAPPXYQLYKRTFPVLLRLACDVDQVTRQLYE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

SSTTTS
SSSSTTGGGTTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence PLVXQLIHWFTNNKKFESQDTVALLEAILDGIVDPVDSTLRDFCGRCIREFLKWSIKQITPQQQEKSPVN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSS
SGGGTTTTTTTTTT

TT

TTS
SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence TKSLFKRLYSLALHPNAFKRLGASLAFNNIYREFREEESLVEQFVFEALVIYXESLALAHADEKSLGTIQ
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TSSSSSTTTSSTTT

SSS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence QCCDAIDHLCRIIEKKHVSLNKAKKRRLPRGFPPSASLCLLDLVKWLLAHCGRPQKEEGVSFLINTFEGG
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) GGG
S

TTTTTTTTTTT

SSTTT


TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence GCGQPSGILAQPTLLYLRGPFSLQATLCWLDLLLAALECYNTFIGERTVGALQVLGTEAQSSLLKAVAFF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS
S





SS

STTTTT
TTTTSS
SSSSSTTS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence LESIAXHDIIASPQEGERYNYSKCTVVVRIXEFTTTLLNTSPEGWKLLKKDLCNTHLXRVLVQTLCEPAS
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)

TTSSGGG
SGGG
TTS
TT
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence IGFNIGDVQVXAHLPDVCVNLXKALKXSPYKDILETHLREKITAQSIEELCAVNLYGPDAQVDRSRLAAV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
STTSTTTTTSSSS
TTS
ST
SS
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence VSACKQLHRAGLLHNILPSQSTDLHHSVGTELLSLVYKGIAPGDERQCLPSLDLSCKQLASGLLELAFAF
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TSSSTTT

S
TTTTS
S
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence GGLCEGSVIHFSHGEYFYSLFSETINTELLKNLDLAVLELXQSSVDNTKXVSAVLNGXLDQSFRERADSW
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)

GGGTST
SS
TT

 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence WAKDSPLETKXAVLALLAKILQIDSSVFTTYISLLADTKLDLHLKGQAVTLLPFFTSLTGGSLEELRRVL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT

TTTTSSTTSSS
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence EQLIVAHFPXQSREFPPGTPRFNNYVDCXKKFLDALELSQSPXLLELXTRRGSCVTQVGLLESVYEXFRK
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT
STTSSS



STT




S



TS
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence DDPRLSFTRQSFVDRTKLNESTFDTQITKKXGYYKILDVXYSRLPKDDVHAKESKINQVFHGSCITEGNE
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SSSTT

GGGGS
STT


T
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence LTKTLIKLCYDAFTENXAGENQLLERRRLYHCAAYNCAISVICCVFNELKFYQGFLFSEKPEKNLLIFEN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

SSS



STTS
S

S





TT
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence LIDLKRRYNFPVEVEVPXERKKKYIEIRKEAREAANGDSDGPSYXSSLSYLADSTLSEEXSQFDFSTGVQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTTSSSSTTTTT


TTT


S
S
TTTTTTTTTTTGG
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence SYSYSSQDPRPATGRFRRREQRDPTVHDDVLELEXDELNRHECXAPLTALVKHXHRSLGPPQGEEDSVPR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GTGGG

S





STS

STTTTTSTTTTT




S
 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence DLPSWXKFLHGKLGNPIVPLNIRLFLAKLVINTEEVFRPYAKHWLSPLLQLAASENNGGEGIHYXVVEIV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTSGGGGTT

SSSTTT

SSTTTSS

 .........1970.........1980.........1990.........2000.........2010.........2020.........2030
Sequence ATILSWTGLATPTGVPKDEVLANRLLNFLXKHVFHPKRAVFRHNLEIIKTLVECWKDCLSIPYRLIFEKF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T
STTTSTTTTTTTTS
TT
SS



 .........2040.........2050.........2060.........2070.........2080.........2090.........2100
Sequence SGKDPNSKDNSVGIQLLGIVXANDLPPYDPQCGIQSSEYFQALVNNXSFVRYKEVYAAAAEVLGLILRYV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S


SSSTTSSTTTTTTSSSSTT


TT
 .........2110.........2120.........2130.........2140.........2150.........2160.........2170
Sequence XERKNILEESLCELVAKQLKQHQNTXEDKFIVCLNKVTKSFPPLADRFXNAVFFLLPKFHGVLKTLCLEV
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S
T
STTS


TTSST
 .........2180.........2190.........2200.........2210.........2220.........2230.........2240
Sequence VLCRVEGXTELYFQLKSKDFVQVXRHRDDERQKVCLDIIYKXXPKLKPVELRELLNPVVEFVSHPSTTCR
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTTTTGGG


TT
SSS
TTTSS
STT
 .........2250.........2260.........2270.........2280.........2290.........2300.........2310
Sequence EQXYNILXWIHDNYRDPESETDNDSQEIFKLAKDVLIQGLIDENPGLQLIIRNFWSHETRLPSNTLDRLL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

SS



TTTTS
SS
TTTS
SS
 .........2320.........2330.........2340.........2350.........2360.........2370.........2380
Sequence ALNSLYSPKIEVHFLSLATNFLLEXTSXSPDYPNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGG
STTSSSTTT



TTTTTTTTTSS

S
 .........2390.........2400.........2410.........2420.........2430.........2440.........2450
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYRHGDLPDIQIKHSSLITPLQAVAQRDPIIAKQLFSSLF
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T
TTTTSSTT


TTTTTSTTSSTT
T
 .........2460.........2470.........2480.........2490.........2500.........2510.........2520
Sequence SGILKEXDKFKTLSEKNNITQKLLQDFNRFLNTTFSFFPPFVSCIQDISCQHAALLSLDPAAVSAGCLAS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TSS

S
S
SS
S

GGGSTTTSS
 .........2530.........2540.........2550.........2560.........2570.........2580.........2590
Sequence LQQPVGIRLLEEALLRLLPAELPAKRVRGKARLPPDVLRWVELAKLYRSIGEYDVLRGIFTSEIGTKQIT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTSTS
STTTT

TTTS
SSTTT

SSTSSTT
 .........2600.........2610.........2620.........2630.........2640.........2650.........2660
Sequence QSALLAEARSDYSEAAKQYDEALNKQDWVDGEPTEAEKDFWELASLDCYNHLAEWKSLEYCSTASIDSEN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT

TTTSTTTTTTTTSTTTTTTT
TS
SS
 .........2670.........2680.........2690.........2700.........2710.........2720.........2730
Sequence PPDLNKIWSEPFYQETYLPYXIRSKLKLLLQGEADQSLLTFIDKAXHGELQKAILELHYSQELSLLYLLQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT
SS
TTGGG
SS
TTTTT

STGGGG
 .........2740.........2750.........2760.........2770.........2780.........2790.........2800
Sequence DDVDRAKYYIQNGIQSFXQNYSSIDVLLHQSRLTKLQSVQALTEIQEFISFISKQGNLSSQVPLKRLLNT
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S

STT

TT


SSS
TTT

 .........2810.........2820.........2830.........2840.........2850.........2860.........2870
Sequence WTNRYPDAKXDPXNIWDDIITNRCFFLSKIEEKLTPISSLIRSCKFSXKXKXIDSARKQNNFSLAXKLLK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TT


SS



TTTTT

 .........2880.........2890.........2900.........2910.........2920.........2930.........2940
Sequence ELHKESKTRDDWLVSWVQSYCRLSHCRSRSQGCSEQVLTVLKTVSLLDENNVSSYLSKNILAFRDQNILL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
STSSSTTTTTTSSTTTTTSS
SSS

 .........2950.........2960.........2970.........2980.........2990.........3000.........3010
Sequence GTTYRIIANALSSEPACLAEIEEDKARRIVIAGLYQRAFQHLSEAVQAAEEEAQPPSWSCGPAAGVIDAY
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT

SSSTTSSGGG


TTTT
S


 .........3020.........3030.........3040.........3050.........3060.........3070.........3080
Sequence XTLADFCDQQLRKEEENASVIDSAELQAYPALVVEKXLKALKLNSNEARLKFPRLLQIIERYPEETLSLX
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S

TTSTTTTTTTTTS
SS


SS
 .........3090.........3100.........3110.........3120.........3130.........3140.........3150
Sequence TKEISSVPCWQFISWISHXVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESYSFKDTSTGHKNKE
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
GGGGTSSTT
SSTTTTTTTT

TTT





 .........3160.........3170.........3180.........3190.........3200.........3210.........3220
Sequence FVARIKSKLDQGGVIQDFINALDQLSNPELLFKDWSNDVRAELAKTPVNKKNIEKXYERXYAALGDPKAP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTSS
SS


TTSSSSS
TTTSTTS
 .........3230.........3240.........3250.........3260.........3270.........3280.........3290
Sequence GLGAFRRKFIQTFGKEFDKHFGKGGSKLLRXKLSDFNDITNXLLLKXNKDSKPPGNLKECSPWXSDFKVE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SS

TT


TTTTSSS
SSSST




 .........3300.........3310.........3320.........3330.........3340.........3350.........3360
Sequence FLRNELEIPGQYDGRGKPLPEYHVRIAGFDERVTVXASLRRPKRIIIRGHDEREHPFLVKGGEDLRQDQR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)



STT


SSS











S


SSTT



TTT

TTS
TTTT
 .........3370.........3380.........3390.........3400.........3410.........3420.........3430
Sequence VEQLFQVXNGILAQDSACSQRALQLRTYSVVPXTSRLGLIEWLENTVTLKDLLLNTXSQEEKAAYLSDPR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTTSSS
TT








SSS


TT
SSSS
SSTTT
 .........3440.........3450.........3460.........3470.........3480.........3490.........3500
Sequence APPCEYKDWLTKXSGKHDVGAYXLXYKGANRTETVTSFRKRESKVPADLLKRAFVRXSTSPEAFLALRSH
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SSTTTTSSSSSS

TT



ST
SS
 .........3510.........3520.........3530.........3540.........3550.........3560.........3570
Sequence FASSHALICISHWILGIGDRHLNNFXVAXETGGVIGIDFGHAFGSATQFLPVPELXPFRLTRQFINLXLP
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S

BS

TTTSSS




SB
T
SSS



SS


S
S
 .........3580.........3590.........3600.........3610.........3620.........3630.........3640
Sequence XKETGLXYSIXVHALRAFRSDPGLLTNTXDVFVKEPSFDWKNFEQKXLKKGGSWIQEINVAEKNWYPRQK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS
S
GGGTTS
SSS


 .........3650.........3660.........3670.........3680.........3690.........3700.........3710
Sequence ICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLXDQATD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

TTTSS
TTTTTSTTTSS


S

SSTTTTS
 .........3720.....
Sequence PNILGRTWEGWEPWX
Predicted secondary structure








SS confidence














Known secondary structure (DSSP) S
STT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D