Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ltiA_

Fold library idPDB HeaderMoleculeTitle
c5ltiA_1.90PDB header: oxidoreductaseChain: A: PDB Molecule: heme dependent oxidative n-demethylase;


Added to library: Thu Feb 9 22:08:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FKPLESYREDFSFRNSPAAIARFPFPFPEDQYMYSVNLEPAVSRDPGSVFEHQFDVDEHYVSEMAERARV
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

S


SSTT










SSSS










STTSTTSSSS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LELDPGRCLVMPHMAQAAWDTLAMLMEHLARDYPQHFRLTRQGDAWHWQNLALGIDQRFTFGDPASLPCE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
GGG
GGG
TTTTTTTTTTT
GGGSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLEYITRQMQGDFAVLDQRDGDLFMDAGMVTCPADWSLRFDAGMSFKQWHSPVPMAHQMGVFDRALKYLL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSSSTT
SS
BS

TT
BTTT
SSTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NIQVGAPVRRLNWTLTINPRLDTSPETYHEWGNDRGKVTPDNVGRLVHLRVELQLMARLPRSNALLFGIR
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T

TT

SS
S
B
GGGGGGGG


TTT
TTT

 .........290.........300.........310.........320.........330....
Sequence TYLISLDELVSNPAWAQRLHRVMRDLPDPIADYKGITRYRQTLVDWLRRFDPEA
Predicted secondary structure












SS confidence





















































Known secondary structure (DSSP) TTS

T
GGGTT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D