Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lsmF_

Fold library idPDB HeaderMoleculeTitle
c5lsmF_2.50PDB header: oxidoreductaseChain: F: PDB Molecule: fmn-dependent nitronate monooxygenase;


Added to library: Thu Feb 9 15:36:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CRLTRLFGIEFPIIQAPMAGVQGSALAIAVSEAGGLGSLPCAMLSLEALEAELTAIRSQTAKPINVNFFC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

T
SSS


TTT

TSB
TT



S

 .........80.........90.........100.........110.........120.........130.........140
Sequence HREPVAQAAKQAAWLEQLAPYFAEFNLRTPYSKAQAEVLAKFKPEVVSFHFGLPDEELLLEIKSWGSKVI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)






TTT







SSS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence STATTVEEALWLEARGADAIIAQGLEAGGHRGHFLSEDLTEQLGTFSLLPQIIAAVEIPVIAAGGIVDAT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSTT
S
TT





S


GGG



SS
SS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence TVRAAMTMGASAVQVGTAYLLCPECNTSAIHREALQSDAAQHTALTNLFSGRPARGIVNRFMAEMGPMNE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
S
GGGTTSTTS


TSGGGG

TTTSS



SS
T
 .........290.........300.........310.........320.........330.......
Sequence AVPDFPLASSAVAGLRTAAERLGFWDFSPLWCGQNASGCRAIPAADLTRSFVLSLPS
Predicted secondary structure



















SS confidence
























































Known secondary structure (DSSP) TS
STTTTTT

TT


B

S

TT


S
TTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D