Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lrvA_

Fold library idPDB HeaderMoleculeTitle
c5lrvA_2.80PDB header: hydrolaseChain: A: PDB Molecule: otu domain-containing protein 7b;


Added to library: Thu Feb 9 12:54:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





TTT
TTS
B
TT
SS
SSS


B


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AASLGMWGFHDRDLMLRKALYALMEKGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTSGGGTTTT
SSGGGT



TS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EPREPVYESLEEFHVFVLAHVLRRPIVVVADTMLRAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)










TTS


SB



SB





TTS
GGGS
SS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEVKLHLLHSYM
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTS
SSB
TT

B

BTT




TT


TTS

S
 ......
Sequence NVKWIP
Predicted secondary structure



SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D