Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lqwX_

Fold library idPDB HeaderMoleculeTitle
c5lqwX_5.80PDB header: splicingChain: X: PDB Molecule: pre-mrna-splicing factor rse1;


Added to library: Fri Feb 10 04:49:23 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DELYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADELKLIAKFQLFATITSM
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)








SB

B


S
SSSSSS


SSB
SSS
B




S


 .........80.........90.........100.........110.........120.........130.........140
Sequence KSLDLPSGSRAFLALTSDSGNLSIVQIHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS
SS
SSSTTTT
S
SSS
SSSS
S
SSSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEIDNAATQLSVHLELGLNHIVK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) BS



SSSS


S



SS
B
S


SSSS



TSTTT



B
 .........220.........230.........240.........250.........260.........270.........280
Sequence KADYLVNPSANFVLSLPDLSRYNITTSLSDNNNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRHK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

TTTT



B
SS

S




BTTB




SS

SSS



TT


TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



S
SS

TT


SSS


S

STTT
SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NFLFQFEKLGVEKNDFSNVLTSSLVFEPSKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKII
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S




S

TTS
S



S
TT












SSSSSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence TLTNAVNYSNLISTSLPPNATKLWLIPDPTTGDNNTLLFITFPKKTMILQIDNTPDEATRSAFLSQDTTI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SSB






SS




S
TT

S



SS

SSS

S
SS



S
 .........500.........510.........520.........530.........540.........550.........560
Sequence HTCLMGSHSIIQVCTAELRHITGKSRYSNWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDLIE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SSS
SS



TTT






STT




SS
TTT

TT

 .........570.........580.........590.........600.........610.........620.........630
Sequence LTTHPELDTMPSKVAIVHADLLAIADNEGMIKIMSLQKEDFLTVISLQLVSEKISDMIMVRDLNLHVGLE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



S





SS



TTS


SSS
SS
SS



SSSB
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence NGVYMKFHIGDVDGSFTDIKRLGLKPVSLISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKMSCVVCHSS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

SSS



SS

TTSSSSSS
BSS


S
 .........710.........720.........730.........740.........750.........760.........770
Sequence STWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHERPRT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT
SS

S


SS




SS



STTSS

SS


SS
 .........780.........790.........800.........810.........820.........830.........840
Sequence ILSFPNNPKSILFIDNHSGKKQCRISLQIDGECLKFGSSDHLYKILDDIDCVIIDFKRLLTYKKLSFLHQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




SS




SSSSS






SS





SSS
S
SS

SSS



 .........850.........860.........870.........880.........890.........900.........910
Sequence TEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTITKIVSMHQWNYERLAVGDIHESVTLF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
SS


B

TTTT

SSS


S
S


SSS
SSS

 .........920.........930.........940.........950.........960.........970.........980
Sequence IWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMNHDPSELSNGAIKYPL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSS

SS






SSSS
TTS

S


SS

TTTSS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence DVITLQQKLPNTKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS


BSSSB
TTS

S
S

SS


TSSS

 .........1060.........1070.........1080.........1090.....
Sequence NIENIMAEADDSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSL
Predicted secondary structure





















SS confidence












































Known secondary structure (DSSP)
S

BS
TTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D