Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lqwQ_

Fold library idPDB HeaderMoleculeTitle
c5lqwQ_5.80PDB header: splicingChain: Q: PDB Molecule: u2 snrnp component hsh155;


Added to library: Fri Feb 10 04:37:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVEGIHDLMFFKPSDHKYFADVISKKKERTLSMLLLKIKTASRRTSMRILTDKAVTFGPEMIFNRLLPIL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)







S


TS
S
SSS

SGGGGTTTTSSSTTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDRSLEDQERHLMIKTIDRVLYQLGDLTKPYVHKILVVAAPLLIDEDPMVRSTGQEIITNLSTVAGLKTI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTS

SSTTSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LTVMRPDIENEDEYVRNVTSRAAAVVAKALGVNQLLPFINAACHSRKSWKARHTGIKIVQQIGILLGIGV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) T


S
STTTTT
TT
T

TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LNHLTGLMSCIKDCLMDHVPVRIVTAHTLSTLAENSYPYGIEVFNVVLEPLWKGIRSHVLSSFLKAVGSM
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)
TS
SSSS
SS

STSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IPLMDPEYAGYYTTEAMRIIRREFDSDEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVAL
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TTT

TTTTS
TSTT

TTSS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence DRPLNKVVTYTTVTLAKKLGSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLETRLIDAL
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
S
SSTS
SS
GGG

 .........430.........440.........450.........460.........470.........480.........490
Sequence LIAFQEQTNSDSIIFKGFGAVTVSLDIRMKPFLAPIVSTILNHLKHKTPLVRQHAADLCAILIPVIKNCH
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)

S

TTTTTTTTT
STTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence EFEMLNKLNIILYESLGEVYPEVLGSIINAMYCITSVMDLDPINQILPTLTPILRNKHRKVEVNTIKFVG
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
GGG


SS
SSTT


S
 .........570.........580.........590.........600.........610.........620.........630
Sequence LIGKLPKEWMRICFELLELLKSTNKEIRRSANATFGFIAPHDVLVALLNNRVCTAVAIGIVAKVCGPYNV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TSS

STTTGGGSS
SS

SS





SSTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence LPVIMNEYTTPETNVQNGVLKAMSFMFEYIGNMSKDYIYFITPLLEDALTDLVHRQTASNVITHLALNCS
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T
TT

SSGGGG
SSSSTTSSS
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence GTGHEDAFIHLMNLLIPNIFETSPHAIMRILEGLEALSQALGPGLFMNYIWAGLFHPAKNVRKAFWRVYN
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S
S
S

SSTT
SS
 .........780.........790.
Sequence NMYVMYQDAMVPFYPVTPDNN
Predicted secondary structure













SS confidence




















Known secondary structure (DSSP) TTT

S
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D