Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lqwO_

Fold library idPDB HeaderMoleculeTitle
c5lqwO_5.80PDB header: splicingChain: O: PDB Molecule: pre-mrna-splicing factor atp-dependent rna helicase-like


Added to library: Thu Feb 9 16:19:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EEDDLLPEEKLQYEARLAQALEEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S


TSS

SS





SGGGST
S

TTSSTTTSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQKTTPKTVLKYMTDGMLLREFLTDSKLSKYS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

S
TT

BTTT
TTS
SS
STT
TT
TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence CIMIDEATLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNRRYPVDIHYTLQPEANY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
SB
TT
S
S
TTSS






S

SS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
TT

S
T




TT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence QPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S


TTS


TT


TT





STTTTSS



STTTTTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PGKCFRIFTKWSYLHELELSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSS
S





B
T

S



SS


SS

TSSS
SSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence GKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFIGRDAAASVLSDHILYLEIFNQW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSS
S
TTTTT



S


SS
STTGGG

SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKNDQARMKIGNIAITRCFISGFPMNIVQL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTTTTT

T

S
SS



TTGGG
TTS
 .........570.........580.........590.........600.........610.........620........
Sequence GPTGYQTMGRSSGGLNVSVHPTSILFAQRPSKYVLYQQLMLTSKEFIRDCLVIPKEEWLIDMVPQIFK
Predicted secondary structure




























SS confidence



































































Known secondary structure (DSSP)
SSS

B

SSS


S



S






GGGS
SSS

S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D