Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lqwC_

Fold library idPDB HeaderMoleculeTitle
c5lqwC_5.80PDB header: splicingChain: C: PDB Molecule: pre-mrna-splicing helicase brr2;


Added to library: Thu Feb 9 17:45:47 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNVETYEQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSLKFNE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
TTS
TT

SSSTT
STTTTTTTTT

S


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVKLMKNENDIIKLSDSKTNPAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPSK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SS










SS











S

S


S








TT


SS




 .........150.........160.........170.........180.........190.........200.........210
Sequence PVIDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



S


BSTTS
TTS
SSS
SB

S




TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TB
SSSSSB
STT

S
TTTT




STTTGGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
GGGTTTGGGGGSSSTTTSSSSSS
S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence GRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKET
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

TTT


GGGSSS



SST

SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S

TTTSS

TTTTT
S
TT

TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIIT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TS
STS



BS


TTTT


TTBS
TTT
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence DQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
STTTS
S



TTGGGTT

SSS


S
T
 .........640.........650.........660.........670.........680.........690.........700
Sequence SSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNRELDEHTTQID
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTSTTSTS
SSS


T

STTTTTTGGG

TT

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence LFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVF
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTST



TTT
SS


S
TTSTT


S
 .........780.........790.........800.........810.........820.........830.........840
Sequence IHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TS
TTS
TTTT
TT

TS


 .........850.........860.........870.........880.........890.........900.........910
Sequence LQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


TTT
GGGSSTS
SSSS



TTTS
S
 .........920.........930.........940.........950.........960.........970.........980
Sequence LMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTS


TTTSS




SS

S

SSSTT





SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FKLPKKFPPPTPLLENISISTSELGNDDFSEVFEFKTFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)













GGG

BSTTSS
SS
SB

T
SS

TTS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence ELALLNHWRQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T
S


S
STT





S
SSS
SS
SS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence QFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTTTTS

SGGGGGSST




S
S
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence FGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFEASAAAAGNRNSSSVFLPSRKD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TTT

B

SS

SS
B



BSS
SSSS

TT


SS
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence CMEVASAFMKFSKAIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SGGGS
SS
S
S
STTTT

SSS
T
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence VSVLLISKDCSAFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS

STTTTS


BS


S
B

TTT
S
B


TTB


SSS
B



B
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence YYKKFLIEPLPTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGIS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTS






TTTTTTS
SSST
T
S

SS
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence VFLSNLVETCLNDLVESSFIEISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SBSSSB
SS




TT

T
SGGGG
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence PLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAYFSRLELPVDFQNDLKDILEKVVPLINVVV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


TTTSSS


SSS
SSST



TT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence DILSANGYLNATTAMDLAQMLIQGVWDVDNPLRQIPHFNNKILEKCKEINVETVYDIMALEDEERDEILT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT
TTT



S
GGGSSTT
TT

ST



 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence LTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWWLV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S



SS
SS


SS
SS

S

B


SS

S

B

 .........1760.........1770.........1780.........1790.........1800.........1810.
Sequence LGEVSKKELYAIKKVTLNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKELSFEINVK
Predicted secondary structure






















SS confidence




























































Known secondary structure (DSSP)
TTTT





SS

SSS
B

TTSSS



B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D