Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lqwA_

Fold library idPDB HeaderMoleculeTitle
c5lqwA_5.80PDB header: splicingChain: A: PDB Molecule: pre-mrna-splicing factor 8;


Added to library: Thu Feb 9 14:29:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KAEMPPEHLRKIINTHSDMASKNYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAIT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




SSSSSS

SS


TT
S





BB
TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence FVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) B





B
ST
SS




SS
S
SSS



SS
S




S




 .........150.........160.........170.........180.........190.........200.........210
Sequence QDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTSS
SS
TTTTSSSBS
TT




TT




TS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCI
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT


SSS




SS








STT
TTTS


S


SSSSS
SS












 .........290.........300.........310.........320.........330.........340.........350
Sequence IQNDEEYDTPALFFDPSLEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYP
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


SS

S


S







SS


TTSS
BS

B
STT

T


SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHR
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S








TT
TT
B





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence KGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT

S

TT



S


STT


SSSSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence ILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERY
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T

STTT
TTSSS

SS




TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence IGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS


SS





TTTS
TT

TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence NIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQR
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T





S

STT


 .........710.........720.........730.........740.........750.........760.........770
Sequence QIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASERE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT

SS
ST


B



TT
SSTSSS

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence ELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQ
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) ST











SSS





 .........850.........860.........870.........880.........890.........900.........910
Sequence RKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
S
TTBSS
TT

SSTTTT
GGG


SSTTTT

TTB
 .........920.........930.........940.........950.........960.........970.........980
Sequence PNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SS

SS

SSS

TTSST

SSS


SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence QFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

S
TSSTT
BSTT
S


TT

SSSS



SSS
TTTS


 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence IRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQRMEEVVSNDEGV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
TTT



STT
SSS


TTTTTS
SS



SS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence WDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEP
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)

TTTB
TTTS
TT
S
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence LLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPAEKLIPTIFRYITTWEN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S


SS



SS
TTTTS





SS
SSS






S

S
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence EFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
S


TTTT
SSSS

TTTT

S
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence ERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SS

S
TT

TTTS





SSTTSS
SS
SS
TT




T
SS
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence LTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


STTTTTGGG

TTTSSS




SSSS


SS



SS
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence SIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESWEVSKPSLLHETNDSLITNKMWFD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTSST









T
SS

B
S




S


SS







S
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence VQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTI
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)




SSS

S
SSSB
SSS
B

TTTT
S


TT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence MKANPALYVLRERIRKGLQIYQSPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
ST








TTSSTT

BGGGGS


TT

S

 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence FTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHML
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) B
B
SSS


GGGGSS
SSS
STTS
SSSGGGTT
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence DFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T
TTS

S

SSGGGTT

SS
B

TTTTGGGTS

 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence ESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTESKNEWRKSAIA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
TT



TT
SS



S

SS

S








S
 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence NTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGGGGGGGS


S

SSS
S
SSS



B
SS
TT




 .........1970.........1980.........1990.........2000.........2010.........2020.........2030
Sequence QLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT





TTSTT
SS

B


SS

SS

TTT
TT

TT
 .........2040.........2050.........2060.........2070.........2080.........2090.........2100
Sequence SVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
S
SS

S

TT

GGGSSS

TTS

B
TTTTT


T
 .........2110.........2120.........2130
Sequence EGDYNFKYGIPLEFYNEMHRPVHFLQFSEL
Predicted secondary structure










SS confidence





























Known secondary structure (DSSP) T








TTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D