Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lphA_

Fold library idPDB HeaderMoleculeTitle
c5lphA_2.25PDB header: cell cycleChain: A: PDB Molecule: centrosomal protein of 104 kda;


Added to library: Thu Feb 9 19:26:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LGEPEPLTEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLXEXPVGTPKEDLKNTLRASVF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)







T
SS
S
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVRRAIKDIVTSVFQASLKLLKXIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
SSTTT

GGG
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EXALFKEVKSLQIIPSYLVQPLKANSSVHLAXSQXGLLARLLKDLGTGSSGFTIDNVXKFSVSALEHRVY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) STTTTS


TT


SSSSS

TT
SS
 .........220.........230.........240.........250.........260
Sequence EVRETAVRIILDXYRQHQASILEYLPPDDSNTRRNILYKTIFEGFAKIDG
Predicted secondary structure






SS confidence

















































Known secondary structure (DSSP) GGGGGGGS

SSTTGGGS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D