Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lpcA_

Fold library idPDB HeaderMoleculeTitle
c5lpcA_3.10PDB header: oxidoreductaseChain: A: PDB Molecule: vanadium-dependent bromoperoxidase;


Added to library: Thu Feb 9 15:51:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNTRRQQAQNIRNNAAELAANRPHPQHINNKEEYEYRRPKKDGNEPSHIANFTKGLPHDEHTGLLLNSAD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S







SSTT

TTB

TTS
B
TTT
SBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YDQFVLGIQSGDTTDFARTPLGPAELPKVHGCLSKQKIDCDDDHRSGFWKSQIAQGAAGGDGAKLRAWES
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) S

S

SSB


SSTTS



BS
SS
S

TTT

STTTS




TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AGAGLVFDLEGPDAQAVTMPPAPRLESPELTSEIAEVYSQALLRDIHFSQLRDPGLGDQVNACDSCPTQL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTSTT


SSSS
TTSS






TTSTTT

GGGSS
GGGS




SS



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SIYEAIDILNTVQIEGQNWFSANCCDLTDDEQARQRPLVTRQNIFRGIAPGDDVGPYLSQFLLIGNNALG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


BTTB
TTT

GGGS
S





TTTTT


STTSSSS
SS
GGGT




SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GGVFGQEAGHIGYGAIRIDQRVRKATPCKDFMTNFETWLDVQNGADLRGLETYVDADPGKCREFPAYRVI
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) S
SS
GGG


TTS


B
TT

B

STT
TT


B



TTSSTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TTPRDLATYVHYDALYEAYLNACLILLGMGAPFDPGIPFGGPQILTLVCEAATRGLKAVRFQKFNVHRRL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
S

TTT

B
TTS


TTT
B
 .........430.........440.........450.........460.........470.........480.........490
Sequence RPEALGGLVDRYKHGKGAGDELKPVAALVEALENVGLLSKVVAHNQLQNQNLDRSGDPSSAGDNYFLPMA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TT
SSTTTTGGGTTTTSTTTTTSGGGSS





BS
 .........500.........510.........520.........530.........540.........550.........560
Sequence FPEGSPMHPSYGAGHATVAGACVTMLKAFFDHGWQLNLGMANGKYISYEPNQDGSSLQQVLLDCPLTVEG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SSS
S
SS
SSS
BTTT



TT
GGGSSSS
 .........570.........580.........590.........600.........610.........620....
Sequence ELNKIAANISIGRDWAGVHYFTDYIESLRLGEKIAIGILEEQKLTYGENFTMTVPLYDGGSIQI
Predicted secondary structure



















SS confidence































































Known secondary structure (DSSP) TS

GGGSSS




TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D