Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lp7A_

Fold library idPDB HeaderMoleculeTitle
c5lp7A_2.20PDB header: transferaseChain: A: PDB Molecule: acetyl-coa acetyltransferase;


Added to library: Thu Feb 9 12:25:28 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAGSGQIPSRQAA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)





TTSTTTTS
TT

GGG


S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSNIPYAVPAGRWGARMGDGELR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

TTS
B

B

GGGTTS
SGGG


TTTTT


SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence DLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWALRSHARAAKAADEGKFQDEIVPVNWINVVDK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SB
TTT

BTT

TTTTTTTB





S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DEAIRRDTSLDQLAKLAPIYASDGSITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
S



S

TS
BSS
SS


BSSSS


TT


S

G
 .........290.........300.........310.........320.........330.........340.........350
Sequence HELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GGTTTTT

GGG



SS


GGGBSTT




TTT
 .........360.........370.........380......
Sequence RILMTLVYELKRRGGGLGVAAICSGAQGDAVLVQVH
Predicted secondary structure








SS confidence



































Known secondary structure (DSSP) TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D