Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lp2B_

Fold library idPDB HeaderMoleculeTitle
c5lp2B_2.60PDB header: cell adhesionChain: B: PDB Molecule: hopq;


Added to library: Thu Feb 9 14:20:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QKLSDTYEQLSRLLTTSAQAINQAVNNLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYAVICGG
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)



TT



STT
GGGB
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence YTKSPGENNQKDFHYTDENGNGTTINCGGTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) BSSSS





TTS




B
BTTTBB
TT



TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence EKLEAHVTTSKYQQDNQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKNTPSWQTAGGGKNSC
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

STT




BB





TTSSSBTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNLNSPSSLTALAQKMLKNAQSQAEILKLA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TSST







TT
TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NQVESDFNKLSSGHLKDYIGKCDQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TSSTTTTTTT




SS

TTS

S
T
 .........360
Sequence ELGNNPFRNM
Predicted secondary structure







SS confidence









Known secondary structure (DSSP) TTSTTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D