Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lnkk_

Fold library idPDB HeaderMoleculeTitle
c5lnkk_3.90PDB header: oxidoreductaseChain: K: PDB Molecule: mitochondrial complex i, nd4l subunit;


Added to library: Thu Feb 9 13:54:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LQYGPLAYILGEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGIHYADSTTGDGKPLP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


SS

TTTT


SS
S
STTTST





SSSSSS


 .........80.........90.........100.........110.........120.........130.........140
Sequence VRFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTTT


TS


SSSSSSS

SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QGFIRKQCVDHYNQVKKVTVCEYLPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTF
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSSS
TTTTS


S


TTTTTS

TTGGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence LPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQDDRKLHNLRMLVQDKLEVLNYTSIPVFLP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS



B

S
TTTTGGGGG
T
SSTS
TTT
 .........290.........300.........310.........320
Sequence EVTIGAHQSDRVFQEFTELPGRKYRAGYNEDVGDKWIWLK
Predicted secondary structure
























SS confidence







































Known secondary structure (DSSP)

TT

SSS


TT

SSSS
SS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D