Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lnk3_

Fold library idPDB HeaderMoleculeTitle
c5lnk3_3.90PDB header: oxidoreductaseChain: 3: PDB Molecule: mitochondrial complex i, 75 kda subunit;


Added to library: Thu Feb 9 15:14:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMK
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


TT
TT
BTT




SS
BTTB


S
S
TTTT
SS
TTT
B

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GWNILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T
SS
S



TTT
TTTTT
TS
S




S










SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAF
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

TT



STT





TTS
SS





TTGGG
SSTTTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVR
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S

GGG


SSTT

TT

BTTTTBT


SSS


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence NEKGLLTHTTWEDALSRVAGMLQSCQGNDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTS




GGG
SS

SS



SS



SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SS
S

S
GGGGGG


S

TTTSSS


S




TT



S
 .........430.........440.........450.........460.........470.........480.........490
Sequence PKILQDIASGSHPFSQVLQEAKKPMVVLGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
SSS

SSTSTTTTT

SS



S
 .........500.........510.........520.........530.........540.........550.........560
Sequence IASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCVTRQDLPKDCFIVYQGHHGDVGAPIADVILPGAA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) STTTT
B
SSS

SS


TTS
TTTS
S


SSS
SSSTTT
S



 .........570.........580.........590.........600.........610.........620.........630
Sequence YTEKSATYVNTEGRAQQTKVAVMPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTS


TT




SS

SSS


TTS

S
SS
SGGGSBS
 .........640.........650.........660.........670.........680........
Sequence VEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTE
Predicted secondary structure









































SS confidence

























































Known secondary structure (DSSP)





TTS




S




S

TTTTTSSTTSSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D