Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lm2B_

Fold library idPDB HeaderMoleculeTitle
c5lm2B_2.54PDB header: hydrolaseChain: B: PDB Molecule: tyrosine-protein phosphatase non-receptor type 23;


Added to library: Thu Feb 9 12:11:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAHEASSLYSEEKAKLLREXXAKIEDKNEVLDQFXDSXQLDPVDNLDAYSHIPPQLXEKCAALSVRPDTV
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)
TT





S
TTTS

TTSTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RNLVQSXQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYXEVH
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TT





SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKASFTNSELHRAXNLHVGNLRLLSGPLDQVRAALPTPALSPEDKAVLQNLKRILAKVQEXRDQRVSLEQ
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TS
TS





 .........220.........230.........240.........250.........260.........270.........280
Sequence QLRELIQKDDITASLVTTDHSEXKKLFEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLS
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)


GGG




TTGGGGTT
 .........290.........300.........310.........320.........330.........340
Sequence DLDQKWNSTLQTLVASYEAYEDLXKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQ
Predicted secondary structure

SS confidence



























































Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D