Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ljyA_

Fold library idPDB HeaderMoleculeTitle
c5ljyA_3.00PDB header: viral proteinChain: A: PDB Molecule: envelopment polyprotein;


Added to library: Thu Feb 9 17:23:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



SS
TT


TTT





 .........80.........90.........100.........110.........120.........130.........140
Sequence FHACTKYEYPWHTAKCHYERCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TT


TTTTSSS

TTBTTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence RHVKVCIIGTVSKFSQGDTLLFFGPLGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS
S

TT
S



S



SS
BTTSTT
STTTTS
B

B





S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGEN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SS


S

S
TGGGS



SS

SS


S


SB
 .........290.........300.........310.........320.........330.........340.........350
Sequence PCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
BSTT

 .........360.........370....
Sequence SGSTFRCCHGEDCSQIGLHAAAPH
Predicted secondary structure


















SS confidence























Known secondary structure (DSSP) TT

TT

B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D