Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lj5Q_

Fold library idPDB HeaderMoleculeTitle
c5lj5Q_3.80PDB header: splicingChain: Q: PDB Molecule: pre-mrna-splicing factor atp-dependent rna helicase prp16;


Added to library: Thu Feb 9 17:56:58 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PSKDDIKHTKEQLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SGGGGG
S
B

TTSSTTT








S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT







TT


SSS



TTT
TT

S
S





TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFPQFTIPGRFPVQTIYTSNPVQDYVEAAVSQA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TT


B

BSS










SS


SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence VKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYINDIEILPIYSALPADLQFKIFQDLHGTKRK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S




SS


S
TTS
TTS


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
GGGSSS


TT






BTTTTB



TTSSSS


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence EDTFKEDMYLQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTTTTTS






TTTT

S
GGGS

S


STSB
TTS
B
 .........430.........440.........450.........460.........470.........480.........490
Sequence MAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSS
TTT
TTS


B


TT

S

TTTTTS
B
 .........500.........510.........520.........530.........540.........550.........560
Sequence EQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVISSGKDWDIIKKCICSGFAHQAAKIT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSTTB
TT





SSS
S
B



 .........570.........580.........590.........600.........610.........
Sequence GLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEY
Predicted secondary structure


























SS confidence


























































Known secondary structure (DSSP) STTB

BTTTTB


TTSTTSS


S
S
S
SSS
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D