Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lj5A_

Fold library idPDB HeaderMoleculeTitle
c5lj5A_3.80PDB header: splicingChain: A: PDB Molecule: pre-mrna-splicing factor 8;


Added to library: Thu Feb 9 19:50:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




B

TSS

SSTTGGGT


TT
S

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S






SS




SSSS
SSS



GGGSSSSS








 .........150.........160.........170.........180.........190.........200.........210
Sequence LDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTTSTTGGGTSSSSSSS
SS
SSBS
TT



TTTT



S
SGGGTT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence NGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) T


TTS




SS






S
SSS
TTT


SS


TTSSSS

S









 .........290.........300.........310.........320.........330.........340.........350
Sequence SCIIQNDEEYDTPALFFDPSLEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKK
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)




SSS

S


SS









TTTT


SS
TTS

S
STT

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence WFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S


SS

S




SS



SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

S
TTS
SS


T


TTTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence DAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
S
STTT
TTTSSS
S
S




 .........570.........580.........590.........600.........610.........620.........630
Sequence LRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

S




TTSSTTS

SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence HLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTR
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T




SSS
T



 .........710.........720.........730.........740.........750.........760.........770
Sequence LWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T

SS
T







TT
TTS
 .........780.........790.........800.........810.........820.........830.........840
Sequence SKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAY
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) S
S











TTS


 .........850.........860.........870.........880.........890.........900.........910
Sequence LDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T
S
TT

TTSSS
STT
S

SS



BTTTTT

 .........920.........930.........940.........950.........960.........970.........980
Sequence LLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
S
TT

SS

SSSTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence AGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SSS


TT

S
SS
SS

S

SS

SSTT



 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence KCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTS
TTTS



TTS
TTT
B

TTT
SSS


TTTTT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence MEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFT
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SSS




SS


TTT




SS
SSS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence YFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSW
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSGGGTT
TT


TTTS
TS
GGGTS






SS

B


 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence SKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS




SB


S


SS




GGGGS

T



TTTSTTSS
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence DRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
BTTBGGGSSSTTTT

S
SS

TT
S



S


TT
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence TILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSGGGGT
S
SSS
S





TT
TTSSS

SSS
SS



TS
SS
SS

 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence VQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKM
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTSS
S

TTTTTTTTTT



GGGGG
S
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence NSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS


S

SSS
S



SS


TTT

SS
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence SMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSNYAEL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
S
SSS

TTTT


TT

T

TTSGGG
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence FNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GSSS


TTSS

B
SS

B




TTT

GGGGTT

S
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence AEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S
TTT

SSSGGGTTS
SSS

S


GGGGGTTSS
SS
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence PQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIES
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SSSS
TTTS

TSSTTS
B
TT
SSB


 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence QMRDLILTEYGRKYNVNISALTQTEIKDIILGNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)






T

GGGGGGGGGS





TTS
 .........1970.........1980.........1990.........2000.........2010.........2020.........2030
Sequence NLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TS
SSS


SS
TT

TT





TTSTT
TT
 .........2040.........2050.........2060.........2070.........2080.........2090.........2100
Sequence WIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS

SS

TTT
TT
TT

SS

TTT

 .........2110.........2120.........2130.........2140.........2150.........2160........
Sequence GFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQF
Predicted secondary structure

























SS confidence



































































Known secondary structure (DSSP) S

GGG
SSS

SS


B
STTTTT

TT








TT
GGG
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D