Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5lj3C_

Fold library idPDB HeaderMoleculeTitle
c5lj3C_3.80PDB header: splicingChain: C: PDB Molecule: pre-mrna-splicing factor snu114;


Added to library: Thu Feb 9 13:18:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNRDYMLSMANIPERIINVGVIG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TTTSTT






S
SS
SSS
SS



S


SS



SS



BSS
STTS


B
 .........80.........90.........100.........110.........120.........130.........140
Sequence PLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTLLCTDLESKSRMI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) STTSSBS

SS

SSS



S

S
S

S



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




STT

S
BTTT
S
TT



TTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence PMDAYLKLNHIIANINSFTKGNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSS



TTTT
STTTT
SSSSS
GGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVYYHKGNFRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
B
TTSSS
BSS

SSS
S
TTS
TT




SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGGAEWSLVRIYS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
SS
T


SS
S



TTT

TTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GLLKRGDTVRILDTSQSESRQKRQLHDIEDDETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAY
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SB

TT
GGGT









TTS

BTTSSSTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSS











SS


SSGGG
SS

TTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence HVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNISVAAEPMDSKMIQDLSR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SSTTS






B


SS












B



 .........640.........650.........660.........670.........680.........690.........700
Sequence PRKLSKILRTEYGWDSLASRNVWSFYNLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)











B


STTTT
SSSS

S
SSSS

B
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence QYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) B
B



SS

T



GGGSSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence RIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


TTSS


TTT
SS
TTTS



SS


SS
SS
SS

S
SSS
 .........850.........860.........870.........880..
Sequence APINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELY
Predicted secondary structure























SS confidence









































Known secondary structure (DSSP)

SSST
S
SSS








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D