Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5livC_

Fold library idPDB HeaderMoleculeTitle
c5livC_2.67PDB header: oxidoreductaseChain: C: PDB Molecule: cytochrome p450 cyp260a1,cytochrome p450 cyp260a1;


Added to library: Thu Feb 9 19:28:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDFPLANLFFVPSEDATAFGRRLRAAAQQAPIVFDTAFGMPILLRKSHITTAYRDTATFSTRMFQAGILN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

S


SS


SSTT
STTTT


TTT
GGGGGSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GGLAAMQGDEHARMRRVYNMFFLPRAVSQYEERFVRPISEQVVDRLAGKPRVDLLEDFAMELPRRVIGEL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TSSTT

TTSTTTTT
SS
BTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FGFPAEKLHETDERVRAMLRGLVRMHDPAAVAESQRAYGETLGLITEVVERESRDTSDTLLGEILRTLKA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T

TT
TT
STT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EHMDTIEASRQIVLSLILGGYETTSWLVANTIHALLAHPDTLARVRQDPSLLPAAIEEGMRWCPSSFGVL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT


TT

GGGS
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence RMVERDVRLDDQALSAGTVVCLAGIAGNYDETAYPSPEVYDIDRKPLPAANVFGGGAHFCVGAPLARMEA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S
TT
TT

GGGGTT
TTTSSSTTS

TT
SS




TT

GGGS
SS
 .........360.........370.........380.........390.....
Sequence RVGLQALLARFPGLRAVPEERPSFMYGAKDSVAHGPDKLPVLLHH
Predicted secondary structure






























SS confidence












































Known secondary structure (DSSP)
TT

TT



TGGG
SSS

B



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D